KEGG   Selaginella moellendorffii: SELMODRAFT_268614Help
Entry
SELMODRAFT_268614 CDS       T01496                                 

Definition
hypothetical protein
Orthology
K11416  
mono-ADP-ribosyltransferase sirtuin 6 [EC:2.4.2.31]
Organism
smo  Selaginella moellendorffii
Brite
Enzymes [BR:smo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     SELMODRAFT_268614
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 319 aa AA seqDB search
MALGYAEKLSFKADVGKLGMPELFDPAQDVDRKIAQLAQLIQESKHLVAFTGAGISTSCG
IPDFRGPKGIWTLQHEGKPLPKADVQFHQARPGTTHMALVELVCAGILKFIISQNIDGLH
LRSGIPRDKLSELHGNSFMETCPSCGREYLRDFEMETIGIKRTGRRCSVPGCVGRLVDTI
VDWEGALPPKELRAAEKHCKEADLIVCLGTSLQITPACNLPLKTVRAGGKLVIATPKDKK
ATLVIHARVDQVILGVMRLLNRNIPPFIRLDHLLVCCSYSWLNNCVKWTLRIESPHGNKA
PLQFIKHVEVSLPLVVRDE
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atggctctcgggtatgccgagaagctctcgttcaaggcggatgtcggcaagctgggcatg
ccagagctcttcgaccccgcgcaagacgtcgaccgcaagatagcgcagcttgctcaactc
atacaagagagcaagcatctggtggctttcacaggcgctgggatatcgacatcgtgtggc
attccagactttcgtggccccaaaggaatttggacgctccagcatgaaggcaagccgtta
ccaaaggccgatgtccagttccaccaggcaagacctggaaccactcatatggcgctggtg
gagcttgtttgtgctgggattctcaagtttatcatcagccagaacattgatggtttgcat
ctgcggtcgggcattcccagagacaagctctcggagctgcatgggaatagtttcatggaa
acatgcccttcatgtggacgagagtatctacgtgatttcgagatggaaaccataggcatc
aagcgcacgggaaggcgatgttctgttcccggctgcgtgggaaggcttgtagatacgatt
gtcgattgggagggagcattacctcctaaagaactacgtgcagctgagaagcattgcaag
gaggccgacctcattgtctgcttgggaaccagcttgcagatcactccagcgtgcaatctg
cctctgaaaacggtgcgagcaggagggaagctcgtgattgcgacaccaaaggataagaag
gcaacgctagttatccatgctcgagtcgatcaggtgattcttggtgtcatgagattgcta
aacaggaacatccctccttttatacgccttgaccaccttctagtctgttgttcctactca
tggttgaataactgtgtcaagtggacgctgcgcatagaaagtccacacggaaacaaggca
cctttgcaatttatcaaacacgtcgaggtaagtcttccgttggttgtgcgtgacgaatga

DBGET integrated database retrieval system