KEGG   Selaginella moellendorffii: SELMODRAFT_268848Help
Entry
SELMODRAFT_268848 CDS       T01496                                 

Definition
hypothetical protein
Orthology
K05759  
profilin
Organism
smo  Selaginella moellendorffii
Brite
Exosome [BR:smo04147]
 Exosomal proteins
  Proteins found in most exosomes
   SELMODRAFT_268848
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 132 aa AA seqDB search
MSWQTYVDSYLMYDLGNGRTLSSAAILGHDGSVWAQSPNFPAVKPEEITNVMNAFDDSSQ
LAQNGLYLSGSKYMVIQGEAGVVIRGKKGSAGVTIKKTSSALVIGLYDEPVAPGECNVVV
ERLADYLIEQNY
NT seq 399 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtggcagacgtatgtcgattcttacctcatgtatgatcttggcaacgggcgcacg
ctctcatcggcggcgattctgggtcacgacggcagcgtctgggcgcagagccccaacttt
ccagcggtcaagcccgaggagattaccaacgtgatgaatgcgtttgacgattcctcgcag
ctcgcccagaacggcctctacctcagcggcagcaagtacatggtgatccaaggcgaggcc
ggcgttgtgatcaggggaaagaagggatctgccggagtgacgatcaagaagacttccagc
gctctggtcatcgggctgtatgacgagccggtcgcgccgggcgaatgcaacgttgttgtt
gagcgcctagcggattacctcatcgagcaaaactactga

DBGET integrated database retrieval system