KEGG   Selaginella moellendorffii: SELMODRAFT_269397Help
Entry
SELMODRAFT_269397 CDS       T01496                                 

Definition
hypothetical protein
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
smo  Selaginella moellendorffii
Pathway
Protein processing in endoplasmic reticulum
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:smo04141]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 367 aa AA seqDB search
MARMLAVLFVALCVIAGAARGEESDVLVLTPDNFDHEVGHERAALVEFYAPWCGHCKKLA
PEYEKVGSAFRKVKHLSIAKASFFLTYIDCDAHKSLCSKFDVSGYPTLKWFPKGSLTPKD
YSGGRTAEDLVAFVNTEGGANAKLSVAASEVVVLTPANFDEIVLDPTKDVLVEFYAPWCG
HCKSLAPAYESVATAYKAEKNVIVAKLDADAHKDLATKYDVSGYPTLKFFPKANKAGEDC
DARSVDEFVEFLNEKCGTYRDSKGALTDKAGTVSSLEDIVQEFVAAKADERESLSTKLHE
AIAKLEGSDAGYGAIYTKVLKSIASKGEEYLAKEHERLSRLLSGAVNPSKADELTVKKNI
ISLFMKQ
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atggcgaggatgctggccgtcttgtttgtggctctgtgcgtgatcgctggagctgcgcgg
ggcgaggaatcggatgtgctcgtcctcacgcccgacaatttcgatcacgaggtcgggcat
gagagggcggcgcttgtcgagttttatgctccctggtgtgggcattgtaagaagctagcg
cccgagtatgagaaggtcggatcggcgtttaggaaagtcaagcacttatcgatcgcaaag
gcgagtttttttctcacatatatagattgcgatgcgcacaagagcttgtgctccaagttt
gacgtaagcgggtatcccactctcaagtggtttccgaaaggatctctcacacccaaagat
tactctggtggacgaactgccgaggatcttgttgcattcgtcaacacagaaggaggtgcg
aatgcgaaattgagtgtggcggcatcggaggttgtcgtcttgaccccggccaatttcgat
gagattgtgctcgaccccacgaaggatgttttggtggaattttacgctccttggtgtgga
cactgcaaatccttggctccggcttatgagtctgtcgcaaccgcatataaggccgagaag
aatgtgatcgtggcaaagcttgacgcggatgctcacaaggatctagcaaccaaatatgac
gtaagtggctacccaacgctgaagttctttcccaaagccaacaaggctggggaggattgt
gatgcgcgctcggttgacgagttcgtggagtttttgaatgagaagtgtggcacttaccgt
gattccaaaggtgctctcactgacaaggccggaactgtctctagtctagaagacattgtc
caggagttcgtagctgccaaagctgacgagcgggaatctctctccacaaagttgcatgaa
gccatcgccaagctagagggctcggacgctggatatggcgcaatctacacgaaagtcctc
aagagcatcgcttccaagggcgaggagtatctagccaaggaacacgagcgcttaagcagg
ctattgtcaggggccgtgaatccctccaaggccgacgagttgacagtgaagaagaacatc
atctcgctcttcatgaaacaataa

DBGET integrated database retrieval system