KEGG   Selaginella moellendorffii: SELMODRAFT_269397Help
Entry
SELMODRAFT_269397 CDS       T01496                                 

Definition
(RefSeq) hypothetical protein
  KO
K09584  protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
smo  Selaginella moellendorffii
Pathway
smo04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:smo00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    SELMODRAFT_269397
Enzymes [BR:smo01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     SELMODRAFT_269397
Chaperones and folding catalysts [BR:smo03110]
 Protein folding catalysts
  Protein disulfide isomerase
   SELMODRAFT_269397
Membrane trafficking [BR:smo04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    SELMODRAFT_269397
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thioredoxin ERp29 Thioredoxin_2 OST3_OST6 Thioredoxin_7 Thioredoxin_8 AhpC-TSA Thioredoxin_6 Redoxin
Motif
Other DBs
NCBI-GeneID: 9637559
NCBI-ProteinID: XP_002988430
JGI: 269397
UniProt: D8SYH0
Position
Unknown
AA seq 367 aa AA seqDB search
MARMLAVLFVALCVIAGAARGEESDVLVLTPDNFDHEVGHERAALVEFYAPWCGHCKKLA
PEYEKVGSAFRKVKHLSIAKASFFLTYIDCDAHKSLCSKFDVSGYPTLKWFPKGSLTPKD
YSGGRTAEDLVAFVNTEGGANAKLSVAASEVVVLTPANFDEIVLDPTKDVLVEFYAPWCG
HCKSLAPAYESVATAYKAEKNVIVAKLDADAHKDLATKYDVSGYPTLKFFPKANKAGEDC
DARSVDEFVEFLNEKCGTYRDSKGALTDKAGTVSSLEDIVQEFVAAKADERESLSTKLHE
AIAKLEGSDAGYGAIYTKVLKSIASKGEEYLAKEHERLSRLLSGAVNPSKADELTVKKNI
ISLFMKQ
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atggcgaggatgctggccgtcttgtttgtggctctgtgcgtgatcgctggagctgcgcgg
ggcgaggaatcggatgtgctcgtcctcacgcccgacaatttcgatcacgaggtcgggcat
gagagggcggcgcttgtcgagttttatgctccctggtgtgggcattgtaagaagctagcg
cccgagtatgagaaggtcggatcggcgtttaggaaagtcaagcacttatcgatcgcaaag
gcgagtttttttctcacatatatagattgcgatgcgcacaagagcttgtgctccaagttt
gacgtaagcgggtatcccactctcaagtggtttccgaaaggatctctcacacccaaagat
tactctggtggacgaactgccgaggatcttgttgcattcgtcaacacagaaggaggtgcg
aatgcgaaattgagtgtggcggcatcggaggttgtcgtcttgaccccggccaatttcgat
gagattgtgctcgaccccacgaaggatgttttggtggaattttacgctccttggtgtgga
cactgcaaatccttggctccggcttatgagtctgtcgcaaccgcatataaggccgagaag
aatgtgatcgtggcaaagcttgacgcggatgctcacaaggatctagcaaccaaatatgac
gtaagtggctacccaacgctgaagttctttcccaaagccaacaaggctggggaggattgt
gatgcgcgctcggttgacgagttcgtggagtttttgaatgagaagtgtggcacttaccgt
gattccaaaggtgctctcactgacaaggccggaactgtctctagtctagaagacattgtc
caggagttcgtagctgccaaagctgacgagcgggaatctctctccacaaagttgcatgaa
gccatcgccaagctagagggctcggacgctggatatggcgcaatctacacgaaagtcctc
aagagcatcgcttccaagggcgaggagtatctagccaaggaacacgagcgcttaagcagg
ctattgtcaggggccgtgaatccctccaaggccgacgagttgacagtgaagaagaacatc
atctcgctcttcatgaaacaataa

DBGET integrated database retrieval system