KEGG   Selaginella moellendorffii: SELMODRAFT_270496Help
Entry
SELMODRAFT_270496 CDS       T01496                                 

Definition
hypothetical protein
Orthology
K00660  
chalcone synthase [EC:2.3.1.74]
Organism
smo  Selaginella moellendorffii
Pathway
Flavonoid biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Circadian rhythm - plant
Module
Flavanone biosynthesis, phenylalanine => naringenin
Brite
KEGG Orthology (KO) [BR:smo00001]
 Metabolism
  Biosynthesis of other secondary metabolites
   00941 Flavonoid biosynthesis
    SELMODRAFT_270496
 Organismal Systems
  Environmental adaptation
   04712 Circadian rhythm - plant
    SELMODRAFT_270496
Enzymes [BR:smo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.74  naringenin-chalcone synthase
     SELMODRAFT_270496
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 386 aa AA seqDB search
MTIQDFQSSGKATVLAVGTAVPPKEFDQSTYPDFFFNVTNCNEKVELKGKFQRICDRSGI
KKRHFYLDEEILKANPGMCTYMEASLDVRQDIAVREVPKLAKEAALKAIKEWGQPKSRIT
HLVFGTTSGVDMPGADFQLLKLLGLRPNVKRVMLYQQGCFAGATVTRVAKDLAENNPGAR
VLVACSEVTAVTFRAPSETHLDGLVGSALFGDGAAALIIGSSPTPVEKPLFEVHWSGQCV
LPDSDGAILGHLREAGLVFHLLKDVPGIISKNIEKLLAEPLDYVKSVDEASPAYTDLFWV
VHPGGPAILDQVEAKLKLDKDRMQATRDVLAQYGNMSSASVLFVLDQMRKRSVELNKDTT
GDGLKWGVMLGFGPGLTVETLLLKSI
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgacgatccaggatttccagagcagtggaaaggccacagtcctggccgtcggcaccgcg
gttccgccaaaagagttcgaccagagcacgtaccccgacttcttcttcaacgtcaccaat
tgcaatgaaaaggtggagctcaagggcaagttccagcgcatctgtgacaggtcaggcata
aaaaagagacatttttacctggacgaggagatcctcaaggccaacccggggatgtgcacg
tacatggaggcgtcgctggacgtgaggcaggacatcgcggtgcgggaggttccaaagctg
gccaaggaggcggccctcaaggcgatcaaggagtgggggcagccaaagtcgagaatcacg
cacttggtcttcggcaccaccagcggggtcgacatgcctggggccgacttccagctcctc
aagctcctcggcctccgcccgaacgtcaagcgcgtcatgctctaccagcagggctgcttc
gccggtgccaccgtcaccagagtcgccaaggatctggccgagaacaaccccggagctcga
gtcctcgttgcatgcagcgaagtcacggcggtcaccttccgggctccgtccgagacgcac
ctcgacggactggtcggctcggctctgtttggcgatggcgccgcggctctcatcatcggc
tccagtcccactcccgttgagaagccactgtttgaagtccactggagcggacagtgcgtt
cttcccgacagtgatggagcaatcctgggacacctgcgcgaggccggcctcgtcttccac
ctcctcaaggacgtccccggcatcatctccaagaacatcgagaagctgctggcagagcct
ctcgactatgtcaagagcgtggacgaggcgagcccggcctacactgacttgttctgggtg
gtccatcccggaggtcccgcgattctcgatcaggtagaggccaagctcaagctcgacaag
gaccggatgcaggccactcgcgacgtgctagcacagtatggaaacatgtcgagcgcctct
gttctctttgttctcgaccagatgaggaagcggtccgtggagctcaacaaggataccacc
ggggacggattgaagtggggtgtgatgctcggtttcggccccggcctcacggttgagact
ctgctcctcaagagcatctag

DBGET integrated database retrieval system