KEGG   Selaginella moellendorffii: SELMODRAFT_270960Help
Entry
SELMODRAFT_270960 CDS       T01496                                 

Definition
hypothetical protein
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
smo  Selaginella moellendorffii
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:smo00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SELMODRAFT_270960
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SELMODRAFT_270960
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SELMODRAFT_270960
Enzymes [BR:smo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SELMODRAFT_270960
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 303 aa AA seqDB search
MAALQGAHSVGMSSAPFIRSSSGRARVFAVAAVGTPVVTGKGVSAKFAQLRELKKIALIP
YITAGDPNLETTADALKLLDARGADIIELGVPYSDPLADGPVIQAAATKALRNGTTLENV
LSMVHEVAPTLSAPLVLFTYFNPILKRGIDNFVASIKEAGVSGLVVPDVPLEETQALREK
TAAQDIELVLLTTPTTPRERMEEIAKSSQGFVYLVSLTGVTGARASLSIRVEELLKDLKQ
VTTKPIAVGFGVSTPEQAAQIAKWGADGVIVGSAAVKLLGESSSPKEGLAKLGAFISEMR
SVL
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atggcggctctacagggcgcgcactctgtggggatgagcagtgcgcccttcatcagatct
agcagtggacgtgctcgggttttcgccgtggcggccgtcggcactccagtggtgactgga
aagggagtcagcgccaagtttgcccagcttcgcgaattgaagaagattgctttgatcccg
tatatcactgctggcgatcccaacttggagaccacggctgatgctttgaagcttctggat
gctcgaggcgcggatattattgagctgggcgttccttactcggatcctttagccgatgga
ccagtgattcaagctgctgccacaaaggctctcaggaatggtacgacgctggaaaacgtt
cttagcatggttcatgaggtagcaccaactttgtctgcgccgctggtgctcttcacttat
ttcaatccaatcctcaagcgcgggattgacaactttgtggcctcaatcaaagaggctggt
gtttctggcttggttgtccccgatgtacctttggaagaaactcaagctctgagagagaag
acagcggcacaagatattgagcttgtgctgctaaccacgccgaccacaccgagggaaaga
atggaagaaatagccaaatcatcacagggttttgtgtatcttgtgagcttgaccggtgtg
acaggggcaagggcttctctcagtatccgagtcgaggagcttcttaaagacctcaagcag
gtgacgacgaagccgatagctgttggatttggtgtttcgacgcccgaacaagcagctcaa
attgctaaatggggagcggacggtgtaattgttggtagcgcagctgtgaagctcttgggt
gaaagtagctccccgaaggaagggcttgcaaaactgggtgcgttcatatctgagatgcgg
agtgtgttgtga

DBGET integrated database retrieval system