KEGG   Selaginella moellendorffii: SELMODRAFT_270960Help
Entry
SELMODRAFT_270960 CDS       T01496                                 

Definition
(RefSeq) hypothetical protein
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
smo  Selaginella moellendorffii
Pathway
smo00260  Glycine, serine and threonine metabolism
smo00400  Phenylalanine, tyrosine and tryptophan biosynthesis
smo01100  Metabolic pathways
smo01110  Biosynthesis of secondary metabolites
smo01230  Biosynthesis of amino acids
Module
smo_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:smo00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SELMODRAFT_270960
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SELMODRAFT_270960
Enzymes [BR:smo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SELMODRAFT_270960
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trp_syntA His_biosynth PcrB NanE FMN_dh ThiG BtpA TMP-TENI PucR ALF
Motif
Other DBs
NCBI-GeneID: 9651065
NCBI-ProteinID: XP_002972455
JGI: 270960
UniProt: D8RMI6
Position
Unknown
AA seq 303 aa AA seqDB search
MAALQGAHSVGMSSAPFIRSSSGRARVFAVAAVGTPVVTGKGVSAKFAQLRELKKIALIP
YITAGDPNLETTADALKLLDARGADIIELGVPYSDPLADGPVIQAAATKALRNGTTLENV
LSMVHEVAPTLSAPLVLFTYFNPILKRGIDNFVASIKEAGVSGLVVPDVPLEETQALREK
TAAQDIELVLLTTPTTPRERMEEIAKSSQGFVYLVSLTGVTGARASLSIRVEELLKDLKQ
VTTKPIAVGFGVSTPEQAAQIAKWGADGVIVGSAAVKLLGESSSPKEGLAKLGAFISEMR
SVL
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atggcggctctacagggcgcgcactctgtggggatgagcagtgcgcccttcatcagatct
agcagtggacgtgctcgggttttcgccgtggcggccgtcggcactccagtggtgactgga
aagggagtcagcgccaagtttgcccagcttcgcgaattgaagaagattgctttgatcccg
tatatcactgctggcgatcccaacttggagaccacggctgatgctttgaagcttctggat
gctcgaggcgcggatattattgagctgggcgttccttactcggatcctttagccgatgga
ccagtgattcaagctgctgccacaaaggctctcaggaatggtacgacgctggaaaacgtt
cttagcatggttcatgaggtagcaccaactttgtctgcgccgctggtgctcttcacttat
ttcaatccaatcctcaagcgcgggattgacaactttgtggcctcaatcaaagaggctggt
gtttctggcttggttgtccccgatgtacctttggaagaaactcaagctctgagagagaag
acagcggcacaagatattgagcttgtgctgctaaccacgccgaccacaccgagggaaaga
atggaagaaatagccaaatcatcacagggttttgtgtatcttgtgagcttgaccggtgtg
acaggggcaagggcttctctcagtatccgagtcgaggagcttcttaaagacctcaagcag
gtgacgacgaagccgatagctgttggatttggtgtttcgacgcccgaacaagcagctcaa
attgctaaatggggagcggacggtgtaattgttggtagcgcagctgtgaagctcttgggt
gaaagtagctccccgaaggaagggcttgcaaaactgggtgcgttcatatctgagatgcgg
agtgtgttgtga

DBGET integrated database retrieval system