KEGG   Selaginella moellendorffii: SELMODRAFT_271323Help
Entry
SELMODRAFT_271323 CDS       T01496                                 

Definition
hypothetical protein
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
smo  Selaginella moellendorffii
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:smo00860]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 520 aa AA seqDB search
MAMAEGETAPVLGSVAVVGAGASGLAAAYRLRAAGVSVTVYEAENSIGGKLKSVSENGFI
WEKGPNTMTENDPSISRMFDDLHLRDKQQFPVEQKKRYIVRNASPTMLPSNPLGFITTGL
FSAQAKLKLLTEPFSWKRTKAESNEDESVGAFMERHFGDEIVDYAVDPFVAGTSGSDPSS
ISIRHSFPELWSLEKNYGSLFVGAIKSGFSKKKKQKLRPVEFEDEDSDFPARTRPRRGGS
FSFVGGMQTLANELVSRIGKEKFKLNTFVTGLACNQQGNPSRQSWTVTGLETSGKRSKRS
DKTFDAVIMTAPVDDVRAMKVVKDGKPYALDYLPTVIYEPMSVLITMFNKDSVKRALPGF
GVLVPSKEQQANGFQTLGTLFSSFMFPDRAPEDQLLFTTFIGGSRNTLLASRSKEELLDI
TLKDLSRLIGVEGQPTAIRHVYWEKAFPRYSIGYDNVLHSIQKLESDLPGLFYAGNHRGG
LAVGKTIVSGLDAAEQVLQYLQGSGGKKVFTMASLEQPVS
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atggcgatggcggagggagagactgctcccgttcttggatcggtcgctgtcgttggagcg
ggcgcgagtggcctcgcggcagcgtatcgattgcgagctgcgggggtctccgtgacggtc
tatgaagcggaaaattccatcggtgggaagttaaagagtgtttcggagaatggattcatc
tgggagaagggaccgaacacaatgacggaaaatgatccaagcataagcaggatgtttgac
gatctccatcttcgcgataagcaacagtttccggtggagcaaaagaaacgatacattgtt
cgcaatgcttctcctacgatgttgccctctaatcctttgggatttatcactaccggtctc
ttctctgctcaagccaagcttaaacttttgacggagccgttttcatggaagcgaacgaaa
gcagaatcaaacgaagacgagagtgtaggagcgttcatggagaggcactttggtgacgag
atcgtagattatgcagtggatccatttgttgccgggacaagtggttcggatccttcctct
atatcaatccgtcactcgtttccagaattgtggtccttagagaagaactatggatcgctc
ttcgtcggtgcaattaaatcaggttttagcaagaagaagaagcaaaaattgcgaccagtg
gagtttgaagacgaagattctgatttccctgctcgtacacgtccccgtcgtggaggatcg
ttttcatttgtaggtggcatgcagacgctggccaatgaactggtctcgaggattggaaag
gaaaaattcaagctcaatacatttgtcaccggattggcatgtaaccaacagggcaatccc
tctcgtcaaagctggacagtaacaggtttggaaacatcgggcaagagaagcaaacgctca
gacaaaaccttcgatgcagtcatcatgacggcaccggtggacgatgtgagggcaatgaag
gttgtcaaagatggaaagccttatgctcttgattatctcccaacagttatctacgaacca
atgtccgtgttgataacaatgttcaacaaagactccgtgaagcgtgcacttccgggtttc
ggtgtgctggttccctccaaagagcaacaagcaaatggctttcaaacgctgggcaccttg
ttctcttcattcatgtttcctgatagagctccagaagaccagctgctgtttacgactttt
ataggaggcagcaggaatacattgctagcatcacggtcgaaggaagagctccttgatata
actttgaaggatttgtctagactaattggagtagagggtcaaccaactgctatcaggcat
gtgtattgggaaaaggcgttcccacgatacagcatcggctatgacaatgtcttgcattct
atccagaaactcgagagcgacctccctggactcttctacgctggaaatcatcgaggagga
ttggccgttgggaaaacaattgtctcaggccttgatgcagcggagcaagtgctccaatac
ctccaaggctctggaggcaagaaagttttcacaatggcgtcgttggaacagcctgtgagc
tag

DBGET integrated database retrieval system