KEGG   Selaginella moellendorffii: SELMODRAFT_272195Help
Entry
SELMODRAFT_272195 CDS       T01496                                 

Definition
hypothetical protein
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
smo  Selaginella moellendorffii
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:smo00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    SELMODRAFT_272195
Enzymes [BR:smo01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     SELMODRAFT_272195
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 284 aa AA seqDB search
MGSAELETPIFPLSAFNVSVVVALLSIVAGALFLLISSRRSKRALDPEKWIDFKLVKRVQ
VSPNVTKFRFALQTPTTILGLPIGQHMMCRGKDRDGADVIKPYTPTTLDSDVGYFELVVK
IYSLGRMSYHFSELKEGDYLSCKGPKGRFTYKPNKFRAFGMLAGGSGLTPMYQVTRAILE
NPADKTKIFLIYGNVTYDDILLKEELDSMVKKFPGRFGVYYVLNDPPADWSGGAGFVTAD
MIKTYCPAPADDIQILRCGPPPMNKAMATHLDALGYSKEMQFQF
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atggggagcgcggagctcgagacgccaatctttccactcagcgccttcaatgtcagcgtt
gtcgtcgccctcctctccatcgtcgccggcgccttgttcttgttgatttccagccgccgc
tccaagagggctttggatcccgagaaatggatcgatttcaagctggtcaagagggtccaa
gttagccccaacgttaccaagtttcgatttgcattgcagactccaaccacgattttggga
cttccaatcggccagcatatgatgtgccgtggtaaagaccgagatggagctgatgtgatc
aagccttacacaccgacaacgctggattcggatgttggttacttcgaactcgttgtcaag
atttattctctaggacgaatgtcttaccattttagcgagctcaaagagggtgactactta
tcgtgcaaaggacccaagggccgcttcacttacaagccaaacaaattcagagcttttggt
atgcttgctggtggttccggcctgactccaatgtaccaggtgactcgggccattttggag
aacccggctgacaaaacaaagatcttcctcatctatgggaacgtgacatatgacgatata
ttgctcaaggaagagctcgacagcatggtaaagaaattcccgggccgctttggagtgtac
tacgtactaaatgaccctccggcagattggagtggtggcgcaggctttgtaacagcggac
atgatcaagacgtactgcccagctcctgccgatgatatccagattttgaggtgtggacct
cctccgatgaacaaagcgatggccacacacttggatgcgctcggctactctaaggagatg
caattccaattctga

DBGET integrated database retrieval system