KEGG   Selaginella moellendorffii: SELMODRAFT_33940Help
Entry
SELMODRAFT_33940  CDS       T01496                                 

Definition
hypothetical protein
Orthology
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
smo  Selaginella moellendorffii
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smo00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SELMODRAFT_33940
Enzymes [BR:smo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     SELMODRAFT_33940
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 399 aa AA seqDB search
LQGFNWESQAKKPWYDTLKSRAAEIQAAGFTDVWFPPPSQSVDKHGYLPTQLYDLNSSSY
GNEAQLRECIDVLHSHNLCCIADIVINHRSGWKQDSTGHWNLYEGGTKDKRLDWGPWALV
SNDIYDSGGKGSKDSGESYGAAPDLDHSNKQVQDELTDWMNWMKAEIGFDGWRFDFVKGY
SPAYTKIYCERTHPSFSVGEYWTSLNYENGRAAANQNTHRQQLCDWIDGTGGLSCVFDFT
TKGVLQDAVKNEYWRLRDGEGKPPGLIAGWYPTKAVTFVDNHDTGSTQRHWNFPDDKVLL
GYVYIITHPGIPCIFWDHFFDWGMKDKISQLMELRRNNGIHSDSKITILAADFDMYVACV
DERLIIKLGNRFDMGTLVPNPTAWKIIMTGPEFAIWENM
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
ctccagggattcaactgggaatctcaagcaaagaagccttggtatgacactctcaagagc
agggctgcggagatccaagctgccggcttcacagatgtgtggtttccaccaccttcacag
tcggttgataagcatggatatttgccgactcagctctacgatcttaactcgtcgagctac
gggaatgaggcccagctgagggaatgcatcgacgtcttgcattcgcataacctgtgctgc
atcgccgacatcgtgatcaaccatcgaagtggctggaagcaagactcaactggacactgg
aacctttacgagggtggaaccaaggacaagaggcttgactggggaccgtgggctttggtc
agcaacgacatctatgacagtggtgggaaggggtccaaggatagtggtgagagctatgga
gcggctccggacctggaccattccaacaagcaagtgcaagacgagctcacagactggatg
aactggatgaaggcagagattggattcgatggttggcgcttcgatttcgtcaagggctac
tcaccggcctacaccaagatatactgcgagaggacacatccaagcttctcggtgggcgag
tactggacttcgttgaactacgaaaacggcagggcggctgcaaaccaaaatacccacagg
caacagctttgcgattggattgatggtactggaggactttcctgtgtgttcgacttcacc
accaaaggagttcttcaagatgccgtgaagaacgagtactggcgactgcgggacggagag
ggaaagcctcccggtcttattgcagggtggtatccaacaaaagctgtaacttttgtcgac
aatcacgacacgggatctactcagagacactggaattttcccgatgacaaagttctcttg
ggctacgtatacatcatcacgcatccgggcataccatgcattttctgggaccatttcttc
gactgggggatgaaggacaagatctcacaactgatggagctgagacgaaacaacggcata
cactcagacagcaagatcacgattcttgcagcagacttcgacatgtacgttgcctgtgtc
gacgaaaggctcatcatcaagctcggaaacaggtttgacatgggcacgctcgtcccaaat
cccacagcgtggaagatcatcatgaccggaccagagttcgccatctgggaaaacatg

DBGET integrated database retrieval system