KEGG   Selaginella moellendorffii: SELMODRAFT_403066Help
Entry
SELMODRAFT_403066 CDS       T01496                                 

Definition
hypothetical protein
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
smo  Selaginella moellendorffii
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:smo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SELMODRAFT_403066
Enzymes [BR:smo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     SELMODRAFT_403066
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 299 aa AA seqDB search
MALAFGGEIYLDLLGIGLRVSNFAAQTAVVLCSTPAFSSRVTICCQRRNSVVVTRERGKN
DKLIKALRNHQIECLELPLIEHTPGPDLHRLALTLQERSFQWIVVTSPEAAAVFANEWKN
AGCPKVKVAVVGDGTKQAFRDTVSQPNFEVGFVSSQATAKVLAEELPKPDGGQSLEVLYP
ASLKASDDLANGLSHRGFKVCRLNTYSTESVKVLPESDVQMALRASVVAFASPTAVKAWM
ELVAKTHDWNGAAACIGGTSAAAARKAGMEKIFYAHNPGIDGSSQKFAFAAGLRAFWRR
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atggcgctcgcgttcggaggtgagatctaccttgatctcctgggaatcgggctgagagta
tcaaattttgcagctcagacagcggtagtgttgtgctccacgccggcattttcgtcccgg
gtcacgatttgctgccagcggcggaattccgtggttgtcacccgggagcgcggcaagaat
gacaagcttatcaaagcactgcgtaatcaccaaatagaatgtttggagctccctttgata
gaacacactcccggtcctgatttacatcgattggcactgacattgcaagaacgatctttc
caatggattgtggtgacatcaccagaggctgctgctgtctttgcaaatgaatggaagaac
gcaggctgtcccaaagtcaaagtggcggttgttggtgacggcaccaagcaagcgttccgt
gacacagtcagtcagccaaactttgaagttggattcgtctcctcccaagcaaccgctaaa
gttctcgcggaggagctcccaaagccggacggcggccagtccttggaagttctctatcca
gcatcactaaaagccagtgacgatcttgcaaatggactatctcaccgcggtttcaaggtg
tgccggctcaacacgtactccactgaatctgtgaaagtccttccagagagtgatgtccaa
atggcactacgggcctccgtcgtagcctttgcttctcccaccgctgtcaaggcgtggatg
gagctcgttgcgaaaacacacgactggaatggagcggcggcttgtattggaggcacgtct
gccgctgctgcaaggaaagccggcatggaaaaaattttctacgctcacaatcctggaatt
gacgggagttctcagaaatttgctttcgcagctgggttgagagcgttttggaggcgctaa

DBGET integrated database retrieval system