KEGG   Selaginella moellendorffii: SELMODRAFT_404548Help
Entry
SELMODRAFT_404548 CDS       T01496                                 

Definition
hypothetical protein
Orthology
K13998  
dihydrofolate reductase / thymidylate synthase [EC:1.5.1.3 2.1.1.45]
Organism
smo  Selaginella moellendorffii
Pathway
Pyrimidine metabolism
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:smo00240]
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:smo00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:smo00670]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 502 aa AA seqDB search
MVLDGTPPPPAAAATLRAFQVVVAATRDLGIGKEGKLPWSVPSDMAFFKRITSEAADARK
KNAVVMGRRTWESIPAKFRPLPGRVNVVLSRAGLELGDKAIVCSSLDSALGILAAPPFDS
SVEAVFVIGGGEVFREAMVSPLCTAIHLTEIQTFFECDTFMPALDLTCFRLWYASSPATV
NNVRHSFHTYVRNKALDVRNVAGTCSLPIPEFVRERHEEYQYLNLIKDIIETGNTRSDRT
GTGTISKFGCQMRFNLRNSFPLLTTKRVFWRGVVEELLWFISGSTNAKVLEDKGIHIWKG
NGSREYLDSIGLSEREENDLGPVYGFQWRHFGARYSTMHDDYTGQGVDQLAEVIDKIKNK
PDDRRIVLSSWNPADLKQMALPPCHMFAQFYVSNGELSCQMYQRSCDMGLGVPFNIASYA
LLTCMIAHVCDLAPGDFVHVLGDAHVYTNHVDPLKEQLENVPKPFPILKIATSNKDIDSF
TAKDFQLVDYESHQRIAMKMAL
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atggtgctcgatgggacgcctccgccgccagcagctgccgctactctccgggccttccag
gtagtggtggccgctacgagggatctgggaatagggaaggaggggaagctgccgtggagc
gtcccctccgacatggcgttcttcaagaggatcacgtccgaggcggcggacgcgcgcaag
aagaatgcggtggtgatggggaggaggacgtgggagagcattccagccaaatttcgaccg
ctccctggccgagtgaatgttgtcttaagccgggctgggctagagcttggagataaggcg
attgtgtgctcgagcttggattcggcgctgggaattctcgcggctccaccgtttgattcg
agcgtggaggctgtgttcgtgattggaggtggtgaagtcttccgggaggctatggtttct
cctctttgcacagcaatccacttgacggagatacaaactttcttcgagtgtgacactttt
atgccggccttggatctcacttgttttcgtctctggtatgcgtcctcacccgcaacagtg
aacaacgtccggcattcattccatacttacgttcgaaacaaggcactcgatgtgagaaac
gtcgctgggacatgctcgttgccgattccagagtttgttcgggagagacacgaggagtat
cagtatctaaacttgatcaaggatatcatagaaactggaaacacgaggagcgatcgcact
ggcactgggacaatctcaaagtttgggtgtcagatgcgttttaacctccgtaattctttt
ccacttctcacaacaaagcgggtgttttggcggggagttgtcgaagagctactttggttt
ataagtggatccacaaacgcgaaggttctcgaggacaaaggaattcacatatggaagggc
aatggctcaagagaatacctcgacagcattggcctctctgaaagagaagagaacgatctt
ggacccgtgtatggctttcagtggaggcattttggagccagatactccaccatgcatgat
gattacacaggacaaggtgtagatcagctagcggaagtcatagacaaaataaagaacaag
ccggatgatcgccgaatcgttttatcatcgtggaatcccgcagacttgaagcaaatggct
ctccctccctgtcatatgttcgctcaattctatgtttccaatggcgagctctcttgccag
atgtatcaacgctcttgtgacatgggactcggtgttccattcaacattgcgtcctacgca
ctcttaacttgcatgatcgcgcacgtctgtgatctggcgcctggagacttcgttcatgtt
cttggcgatgctcatgtctacacgaatcatgttgatccgctcaaagagcagctggagaac
gttccaaagcccttccctattctgaaaatcgcgaccagtaacaaggatatcgattccttc
acggccaaagattttcaactcgtcgactacgaatctcaccagagaatagccatgaagatg
gctctgtga

DBGET integrated database retrieval system