KEGG   Selaginella moellendorffii: SELMODRAFT_407438Help
Entry
SELMODRAFT_407438 CDS       T01496                                 

Definition
hypothetical protein
Orthology
K04437  
filamin
Organism
smo  Selaginella moellendorffii
Brite
Exosome [BR:smo04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   SELMODRAFT_407438
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 1810 aa AA seqDB search
MELSRFVHWFLWWSWLLWAPRFVISQPGRDCLMLCSQNITCALECAACDFDCCSSTCDSA
RPGAVCDPFCYVSSLDVSDCCVSAPSPPPTPAPIIPGPGNCSVIDILAVNITMVEGVPFT
FNIVAIDSSCSGSTCSCTTPYDGSPSLFQVRIFDSGTGFTPPNTACNVSEGSSSGVFSVS
CLAQNSIADANAQYILFVTLFSYGFWVVPIGFSSPAITIISGPVYVPACVATWSNNSSTF
VAGTMATLQITQKDAFNNTVGGKTGRSVLYSFQLAVIANPAVNTSTSFPSFNVSGNATEA
GRFYLQVGNGTHVIQKAPFRFYVVPGPLSINDSSAVWPNGVNSFEAGTNSSLAILQLDGF
SNSIPNMELLLSFYYSDGSTLAPLNVTVAPLEIDTDYIAATFMPIQAGQYYLHVGNGSQE
LQLSPFTFSVFSGSIAVENCKGSWTGFKSTFYAGERAEFNVLEMDGYGNNVSLSTGSLSS
YDFSVNVSTASDYQLFAMPSLALLPPELGSAYRIVTFYPQVSGTYLLNVGSDIVNISNSP
FLFRVFPGMSYQHTDLHGVLAKWQPISSGMSLSSDIPVGSLPDLGVQVQNINGTDYNLMT
FMSTLSGDFACEVGSSTDTITNSPLGFFVNASSVSTSACLPSWPKGLNRFPAGTEATLHV
LLKDVYNNTVSSITGGYDYNFQLSADISGSANSSLGYNVSFADNPSAGIKTVKFYPTLAG
SYWLGLWSPSANLTGSPFQFTVTAGSVSVWNCTASWLGGVNVFDAGTQAVIQILLMDAYG
NNVSLATGRNDSYNFVVEVQGYPDAINNWNVTVVPQNFSGYQSVVFFPVDAGQFNLRIGS
KSKNISGSPFPLTVNPGFLSVPDCSGEWLNGIEFYLQNTTVTFLLYPKDVFGNALPSNGL
TAANFTALVYFQSNLSMLGVPSLAVTQMTNYSLAFRFNMTKVGRFILQIGNASEDISGSP
YLFTVTTDNVDPSRTIIDGTGLKNSTAGVKSEFLVQLRDSAGNTAYANASDMSVRFTRFG
LPINVTTNISIVPKSSGAFLIAYVPTLAGDYKIVTQWKGLVLGGGPAIKKSVLPASIYGP
WCRATYSGVSQGEAGLTTSFLVTTFDAFNNTMPTGPVNISIKFSPAVTQATTITNNRNGT
YTVKCNVTKSGTYGVFVYAGSLTPSNLTTGSPFQITVSSGPIAISQCRGVFMDGNVISEG
SAVRFLLLLRDKFKNKVYQVLNETVTAMFTASVYTTGGEGPVFTSDMTVQQFATFTYASD
QVLIAFTMTERGDFKLQVVSGLTKINSGVPYYFSIVQEAPSVLNSTFNGTGIIDSTAGDL
TTISITLRDHFGYPVVTDTSLIVVNASSMDDTFFLLAKVFELQAEDGRYVSNYTATVAGD
YTVSISWSDVRLVSYNKTVSPGPPLPEQCVASGDGLSGGEAGTNLEFNISAYDRFRNPCA
PGAISFIVQFDPPFASVAATWVGGQDFSVNYTIWKAQNYSMTVIAVGSDAQVPLPGSPFP
VTIYPGPPDTTVAYVTGEGVSILASVLKWNEVVVIMVDVFENPVTVDSSGFKLSVTGPGA
STYRSFVLLSPGKYLASYKVPSQGFYAVTVSYEDLLLPECPLNVSVGSVKETAKDFRATI
SPNTSLPAGEDVTVTIFANYTTNKTMKFIVELASEELTVGLIPDERNGKYSATINATLSG
SYIADITLYGSQIKGTYTLQVKPGAVHVPLCAVIEMAAESIATTGVPKQVRIQTRDKFGN
NAYSDVDENGNTVTFVMILSGPTMEEFSMDYVSEGMFVGNFVAREPGIYDLSIMAGLVDI
SGSPFMVTVS
NT seq 5433 nt NT seq  +upstreamnt  +downstreamnt
atggagctctcgaggttcgtgcattggtttctctggtggagctggcttctgtgggcgccg
cgattcgtaatatcgcagccagggcgcgattgcttgatgctgtgctcgcagaacatcacc
tgcgcgttagaatgcgcggcgtgtgacttcgattgctgcagctccacttgcgattcagct
cgccccggcgctgtttgtgatccattttgctatgtctccagtctcgatgtgagcgattgc
tgcgttagcgctccatcgccgcctccaactccggcccccattataccagggcctggaaac
tgcagcgttatcgacattcttgctgtaaacatcacgatggtcgagggagtgccgttcact
ttcaatattgttgccatcgattcgagctgcagtggatcgacttgctcgtgcactacacct
tatgacggatcgcccagcctttttcaagtacgtatcttcgattccggaactggatttact
ccacccaatactgcctgcaacgtgagcgaggggtccagttctggagtattttccgtgtca
tgccttgctcaaaattccattgcagatgccaatgctcaatacatcctttttgtgactctc
ttttcctatgggttttgggtggttcctatcggattttcgagcccggccatcactatcatt
tccggtcctgtgtatgttcctgcatgtgttgctacatggtccaacaatagcagcaccttc
gttgctggcacaatggctacgctgcagataactcaaaaagacgcattcaataacactgtt
ggtggaaagactggacgaagtgtactatacagctttcagctcgccgtaattgccaaccct
gccgtgaacacctcgacgagctttcccagtttcaatgtctctggtaacgcgactgaagcc
ggtagattctacttgcaagttggaaatggcactcacgttatccaaaaggcaccgttccgc
ttttacgtggttccaggtcctctttctattaatgacagttcagctgtttggccaaacgga
gttaattcctttgaggcagggactaattcttctctagcaatattacaactcgatggattc
agcaattctattccaaatatggagctacttctaagcttttactactcggatggcagtaca
ctggcgcctctgaatgtaacagttgctcccctcgaaatcgacacggattatattgctgca
acttttatgccaatccaagcaggccaatattatctgcacgttggaaatggatcacaagaa
ttacaactttcacccttcacattttcggtattttcaggttcaattgcagtggaaaactgc
aagggttcctggacgggattcaagtctaccttctatgctggagaacgagctgaatttaat
gtgttggagatggatggttacggcaataatgtcagcttatccactggcagcttaagctcg
tacgacttttctgtcaacgtgagcactgcgagcgactatcaactgtttgcgatgccgagc
ctggctttacttcctccggagcttggatcagcttacaggatcgtaacattttatcctcaa
gtttcgggaacatatttgctgaacgttggcagcgacatcgtcaatatttcgaattctccc
ttcttattccgagtttttccaggcatgtcctatcagcataccgacctgcatggggttttg
gccaaatggcagccaatttcaagcgggatgagcctctcgagcgacataccagtaggaagc
ttgccggatctgggagtgcaagtgcaaaacatcaacggcacggattacaacctgatgact
ttcatgtcaactctttctggagattttgcctgtgaagttggaagtagcactgacaccatc
acaaactcgcctcttggttttttcgtgaatgcgagttcggtgtccacttccgcatgtcta
ccatcgtggccgaagggcttgaatagatttcctgcgggaactgaagccacgcttcacgtc
ctactcaaggatgtctacaacaacaccgtgagctcaattactggcggatatgattacaat
tttcagctgtcagccgacatttctggaagtgctaatagttctctaggatacaacgtgagc
tttgccgataatccttctgcaggcattaaaacagtcaaattctatccgaccttggccggc
agctactggctgggtttgtggagtcccagtgcaaatctaacagggtcacctttccagttt
actgttacagcaggctctgtatctgtttggaattgcacagcctcctggcttggtggcgta
aatgttttcgacgcgggaactcaagcagttatccaaatccttctcatggatgcgtacggg
aataatgtcagcttggcaacaggaagaaacgactcctacaactttgttgtcgaagtacaa
ggctatcctgatgctataaacaactggaatgttacggttgttcctcagaacttctccggg
taccagtccgtagttttctttccggtggatgccggacagttcaacttaaggattggaagc
aagtcgaagaacatatccgggtcgccgtttccattgactgtaaacccaggattcttgtcc
gtgccggattgctctggcgagtggctcaatggtatagagttctacctacagaacacaact
gtgacattcttgctctatccaaaagatgtgtttgggaacgctttacccagcaatggcctc
accgcagcaaactttacggcgctcgtttatttccaatcaaacctgagtatgctgggagtt
ccaagcttggccgtgacacagatgacgaactactcgctggcattcagatttaacatgacc
aaagttggaagatttatcttacagattggaaatgcatcagaagacatttctggatcgcca
tacttgttcacagtgaccacagacaacgtggatccttcgagaaccataatagatggtact
gggctaaagaactcaaccgctggtgtcaagtcggagtttcttgtccaacttcgcgacagt
gcaggaaatacagcatacgcaaacgctagtgacatgagcgtccggtttacgaggttcggc
cttcctatcaacgtaacaactaacatttctatcgttcccaaatcgagtggtgcattccta
atcgcgtatgtgcccacacttgctggggactacaagattgtgacgcagtggaaagggctc
gttctagggggaggtcctgcaataaaaaagagcgttcttccagcaagtatatatggaccg
tggtgcagagctacgtattctggggtgtcacagggagaagcgggcttgactacgagcttc
cttgtcacaactttcgacgcattcaacaacacaatgccgacggggccagtgaatatctct
ataaagttttctccggctgtcacccaggccacaaccatcaccaacaatcgaaatggaacg
tatactgtcaagtgcaacgtcacaaaatctgggacctacggtgtgtttgtttacgccgga
tcgttaacgccgagcaatctcaccactggcagcccgttccagatcactgtttcatcaggt
ccaatcgcgatatctcaatgtcgcggggtgtttatggacggaaatgtgataagtgaaggc
agtgcggtgagattccttctcttactgcgagacaagttcaagaacaaagtctaccaggtt
ctaaatgaaacagtcactgccatgtttacggcgtccgtctacacgactggtggcgagggg
ccggttttcacgtcggacatgaccgtccagcagtttgctacatttacttacgcaagcgac
caggtgttgatcgcttttacaatgaccgagcgcggggatttcaagctccaagttgtcagt
ggccttacgaagataaactccggagtcccgtattatttttctatcgtgcaagaagctccg
agcgtgctcaacagcaccttcaacggaactggcatcatagactccactgccggggacctt
actacgatttccatcacgctcagggaccactttggctatccagtcgtgacggacacaagc
ctcatcgtcgtaaacgcttcgtcaatggacgacaccttctttctactcgcgaaggttttc
gagcttcaagcagaagatggaaggtacgtgtcgaactacaccgccaccgtcgctggcgat
tacacggtttccatttcatggtcggatgttcgtctagtttcttacaacaagaccgtctct
ccaggtcctcctttgccagagcagtgtgtcgccagtggcgatggtctctcgggtggcgaa
gctggaacgaatctagagttcaacatctcagcatacgatcggtttcgcaatccttgtgct
cccggcgccatctctttcatcgtccagttcgatccaccgttcgcaagcgtggccgcaact
tgggttggaggccaggacttctcggtgaattataccatctggaaggctcaaaactacagc
atgactgtcatagcggtgggttccgacgctcaagtgccactcccaggcagtcctttccct
gtcaccatttatccagggccgccggacacgaccgttgcttatgtcaccggcgaaggggtg
tcaattctagcatcggtgcttaaatggaacgaagtcgtggtgatcatggtggacgtcttc
gagaatccagtgacggtggacagttctggctttaaactcagtgttacgggacctggagct
tccacttatcggagcttcgtccttctttcgccagggaagtatcttgcctcgtacaaggtc
ccttcgcaaggattctacgcagtcacggtctcgtacgaggatctccttcttcccgagtgt
ccgctcaacgtatctgtcggctctgttaaagagacagccaaagatttcagagccacgatt
tcacctaacaccagtctacctgctggagaggacgtgaccgtcaccatctttgcgaattac
acgaccaacaagacgatgaaattcatagtcgagttggcgtcggaagagcttacggtggga
ctgatacccgacgaacgcaatggaaagtattctgcgaccatcaacgctacgctctcgggc
tcgtacatcgctgacattaccctctatggttcgcaaatcaaagggacatacactctgcaa
gtcaaaccaggtgctgttcacgttcctctctgcgctgttatagagatggccgcagagagc
atagctacaaccggggttccaaagcaagtgagaatccaaaccagggataaattcggcaac
aatgcttatagcgacgttgacgagaatggaaacactgtgaccttcgtcatgatcctctcg
ggcccaaccatggaggagttttcgatggactacgtatcagaagggatgttcgtcggtaac
tttgtggctcgcgagcccggcatttatgacctctccatcatggctggccttgtggatatc
agcggcagcccgttcatggtaactgtgtcctag

DBGET integrated database retrieval system