KEGG   Selaginella moellendorffii: SELMODRAFT_409868Help
Entry
SELMODRAFT_409868 CDS       T01496                                 

Gene name
HBT1-1
Definition
hypothetical protein
Orthology
K03350  
anaphase-promoting complex subunit 3
Organism
smo  Selaginella moellendorffii
Pathway
Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:smo00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    SELMODRAFT_409868 (HBT1-1)
Protein phosphatases and associated proteins [BR:smo01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     SELMODRAFT_409868 (HBT1-1)
Ubiquitin system [BR:smo04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   APC/C
    other subunits
     SELMODRAFT_409868 (HBT1-1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 655 aa AA seqDB search
MEACLVDSINASLKLYMYRNATFLCERLYAESATEANLHLLATCYFRSNQAYRTYYLLKG
IKSPQCRYLFALACFEMGNMAEAEAALQPSDSPSEVPNGAAGCYLLGLICRFTDRRQAAI
AHYTQALSVDPFFWSAYEDLCLLGVEEDPLSQSQWEVKSQYTYNTPSPSVSQLVTTKSTV
APVHPQRRKFLDEGKLRKVSGRLFTEPPRRSLRLSAESPSTINVCSIPSPVAVSTPTSTA
SVRVSSNSSVRVSNSRKIISGSAEGPLDDGRRVYESLETLGSDEMSNTSSQQSSPVIDEE
LRRSVSVGFVSRGSKLGEGATELLALLKVLGEGFKHVCMYESQEALEAFAKLPQNQYETG
WVLCQIGRAYFEMVDYAEAERAFSWARRVSPYRLEGTDIYSTVLYHMKKDVELSYLAQEV
VSMDRLSPQAWCVIGNCFSLQKDHETALKFFQRALQLDSHFTYAYTLCGHEYVAMEDFEE
GLTCYRNAIRMDGRHYNAWYGLGTIYLRQEKYELAEYHFRRALQINERSSVLHCYLGMAL
HALKRSHEALELLGEAIRADPKNPLPKYQKANVLMSEERYNDALGVLEQLKEVAPRESSV
YFLIGKVYKRLGQPESAMYHFCVALDLKPSTADVNLIKNAIEKLHVPDESEEENL
NT seq 1968 nt NT seq  +upstreamnt  +downstreamnt
atggaggcgtgcctcgtcgacagcatcaatgcgtccttgaagctctacatgtatcgcaat
gccacattcctctgcgagcgcctctacgcggagagcgctaccgaggcaaatcttcacctt
ctcgcgacctgttattttcggagcaatcaagcgtaccgcacatattacctccttaaaggc
attaaatcgccacagtgtcggtatctatttgcactggcctgctttgaaatgggtaacatg
gctgaagctgaagctgcgctacaacccagtgattctccatccgaggttccaaatggagca
gccggttgctatctgctaggacttatctgtcggtttacggaccgcagacaagctgctatt
gcgcactacacgcaggcgctgtctgtggatccattcttttggtcagcttacgaagatttg
tgtctgctaggtgttgaggaagatccactatcacaatctcagtgggaagtcaagtctcag
tatacatacaacacgccttctccaagcgtttctcagttagtgactacaaagagtactgtt
gctcccgttcatcctcagagacgaaagttcctcgacgagggaaagcttcgaaaggtgtcc
ggtagattattcactgagcctcccaggcggagtttgaggctttctgccgagtctccatcc
acaatcaatgtttgctcaattccaagtcctgtagccgtgtcaacacctacgtcaactgcg
agcgtccgggtatccagcaatagctccgtccgtgtttctaattcgcgtaagattatttcc
ggaagtgccgaaggtcctcttgatgatggccgaagggtttacgaaagcttagaaactctt
ggaagcgatgaaatgtcaaataccagcagccagcagtcttctcctgtgatagatgaggaa
cttcggcgcagtgtctccgttggctttgtgtcccggggctcgaagcttggggagggtgct
acagaactcttggctcttctaaaagttcttggtgaaggcttcaagcatgtttgtatgtac
gaaagtcaggaagcactagaagcttttgcgaagctcccacaaaatcagtatgagactgga
tgggttttatgccaaatcggaagagcatactttgagatggtggattacgcagaagccgag
cgtgctttcagttgggctcggagagtgtcaccctacaggcttgaaggaactgacatctac
tcaaccgtgctctatcacatgaagaaggacgtggaactgagctatctcgcgcaggaagtg
gtatcaatggacagattgtctccacaagcatggtgtgtgattggaaactgctttagtttg
cagaaagaccacgaaacggcactaaagtttttccagcgggccttacaactcgattctcac
ttcacatacgcgtacactctatgtggacacgaatatgttgcaatggaggacttcgaagaa
ggccttacttgctatagaaacgcgatacgtatggatggacggcactacaacgcgtggtat
ggacttggtacaatctatctacgccaggaaaaatatgagttggctgagtaccactttcgt
cgtgccttgcaaatcaatgaacgctcttcagtgctccactgctacctgggaatggcgctg
catgctctaaagaggagccacgaggctttggaactgcttggcgaagcgatacgggctgat
cccaagaatcctcttccaaagtaccagaaagcgaacgttctaatgagcgaggagagatac
aacgacgctctcggagtcctggagcaactcaaagaagtcgcgcctcgcgagagcagcgtc
tacttcttgatcgggaaagtctacaagcggcttggacagccagagagtgccatgtatcac
ttttgtgtcgcgttggatctcaagccatccactgcagacgtgaatctcatcaagaatgcg
atagagaagcttcatgttccagacgagtcagaagaagagaacttgtaa

DBGET integrated database retrieval system