KEGG   Selaginella moellendorffii: SELMODRAFT_410118Help
Entry
SELMODRAFT_410118 CDS       T01496                                 

Definition
hypothetical protein
Orthology
K08825  
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase [EC:2.7.12.1]
Organism
smo  Selaginella moellendorffii
Brite
Enzymes [BR:smo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     SELMODRAFT_410118
Protein kinases [BR:smo01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [Table]
   SELMODRAFT_410118
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 867 aa AA seqDB search
MRTDNGTKLDYFSSWSQHDVLGTPRRGMRRPSLGSSKVGLPAAPKSGGLKRSNEFRSQAL
PTLNLAKIKQNLEQQQQQQQQQQQEESASSSQDLGKDESFEPTGTQSTPASSRGDRRNYL
LKRSAKESPLFNALAGDYGGDHATNKGYHAETARFTENREKLPKYSYPYSVTQLMSSSDR
KFNGDSYAVKNGSMTTRNFQNNNDREPSESRLSGGLNSEVDNAKTKKSESTLQAKKLSLR
LVSSLEEALAKVSKPDWEARKLSLHLTKDPFSVTARTNQDSYPSVAAKFHGNLHYLNLKD
EKHSQEDAAKMSDSYRLHEDYNSQGSHGAVSKDRADCVKVKSLKLPVDKHSSAVPLGFGG
NPVECVQTARLANAISSEQNPRLAVADRSRRTLSSYQRRKKTDAPTFPSLPPGVLATPEI
VLKQCSSHMSEYEHQEILPYQEVFFIGANSHKIQTSSTSGNCNYGYDDDRGDYLIVERDH
LAYRYEIVGILGKGSFGQVLKCIDHKLKSLRAVKVIRNKKRFHQQALIEVKILEHLRDKA
TEESANYNIVTIHESFYFRGHLCITFELHDISLYDLIKKNNFQGISMAVIRDIAIQVLQA
LKFLRKLHVIHCDLKPENILLHHPSSSKIKVIDFGSSCFEHEKIYTYIQSRFYRSPEVIL
GLPYDVMIDVWSFGCILAELCSGCPLFPGENEVEQLACMMEILGTPPDFLLENATRKKMF
FDSSNHPRIVPNSWGKKYWPGTKNLSTALRCNNPLFINFLECCLRWDKNQRMTPDDLLQH
AWILEVPTSANRLPLQPSNQDTSKRRSMKSSETPHRSFKQSKQNSTSVVKSHLKLSNLGK
CADIPNVLPPIGEALTFRTLQERKKAV
NT seq 2604 nt NT seq  +upstreamnt  +downstreamnt
atgaggaccgacaacggtacgaagctggattacttctcttcctggtcgcagcacgatgtt
cttggcactcctcggcgtgggatgaggcggccgtcgctgggatcgtccaaggtagggctg
cctgcggctccaaagtctggcggtctcaagaggagcaacgaattccggtcgcaggccctc
ccgacgctcaatctggccaagatcaagcaaaatctggagcagcagcagcagcagcagcag
cagcagcagcaggaagaatcggcctcgtcgagccaggatttgggaaaggatgaatcgttt
gagccgactggaacgcagtccactccagctagttctagaggggatcgaaggaattaccta
ctcaagagaagcgccaaagagagcccgctgttcaatgcacttgctggggactatggtggc
gatcacgccacaaacaaggggtatcacgccgagaccgcgaggttcacggagaacagagaa
aagcttccgaagtactcgtatccttactcggtgacgcagctcatgtcttccagcgatagg
aagtttaacggggatagctacgcggtgaagaacgggagtatgacgaccaggaactttcag
aacaacaatgacagggagccatccgagtcgaggttgagcggtggattaaactcggaggtg
gacaatgccaaaactaagaagtcggagtcgactttgcaagctaagaagctgtcgctgcgc
ttggtgagttctctggaggaggcactggccaaggtgagcaagccggattgggaagccaga
aagctctcgctgcatttgacgaaggatccgttctccgtcacggcgaggacgaaccaggat
agctatccttccgtggcggctaagttccacgggaacctccactacctcaacttgaaagat
gagaagcattctcaagaggatgcggccaagatgagcgatagttacaggcttcacgaggac
tataattcacagggaagtcatggagctgtttcaaaggatcgggcagattgcgtcaaagtg
aagtccttgaagctgccggtggacaagcattcaagtgctgttcctcttggctttggtggc
aatcctgttgaatgcgttcagacagccaggcttgcgaacgctatttcttccgagcaaaat
ccaagactagccgttgcagataggagtcgcagaaccttaagtagctatcagagaagaaag
aagacagatgctccaactttcccgtctcttccacctggtgtacttgcaacaccagaaatt
gtgctgaagcaatgctctagtcatatgagcgagtatgagcaccaagagattcttccgtac
caagaagtcttttttatcggcgccaactcacacaaaatacaaacgtcgagcacgtctggc
aattgtaactacggatatgacgatgacagaggagattaccttattgttgaacgcgatcat
ctggcttatcggtatgaaatagtgggtattttggggaagggtagctttggtcaagtgttg
aagtgcattgatcacaagctcaaatcactgagagccgtgaaagtcattcgcaacaagaaa
aggtttcatcagcaagcgttgattgaagtcaagattctggagcacctccgcgacaaggct
acagaagaatctgccaactataacatcgtaaccatccatgagagcttctactttcgaggc
catttgtgcatcaccttcgagcttcacgatatcagcttgtacgacttgatcaagaagaac
aacttccaggggataagcatggcggtgatcagggacattgccatccaggttctacaggca
ctcaagttcttgcggaagctgcacgttatccattgtgacttgaagcccgagaacattctc
ctacaccatccttcgtcctcaaagatcaaagtgatcgactttggatccagttgcttcgaa
catgagaagatttatacatacatccagagccgtttctatcggtccccagaagtcattctc
ggcctaccttacgatgtcatgattgacgtttggagctttggttgcatcctagctgaacta
tgctctggatgtccattatttccgggagaaaacgaagtggagcagctagcttgtatgatg
gagattcttgggacaccaccagactttttattggagaatgcgacgcgaaaaaaaatgttc
ttcgatagcagcaatcacccgaggatagttcccaactcttggggaaagaagtactggcct
ggaaccaagaacctctcgacggcacttcggtgcaacaacccactctttatcaactttttg
gaatgctgcctgcgttgggataaaaaccagcgaatgactccggacgatctcctacaacac
gcatggattcttgaggtaccaacgtccgcaaacaggcttcctttacagccttccaatcag
gacacgagtaagagaagatcgatgaagagctccgaaactcctcacagatctttcaagcaa
tccaagcaaaactccaccagtgtcgtcaagagccacctaaagcttagcaatttgggcaag
tgcgccgacattcccaacgtattgccgcccattggagaggcgctcacatttagaactcta
caagagaggaagaaggccgtgtaa

DBGET integrated database retrieval system