KEGG   Selaginella moellendorffii: SELMODRAFT_410685Help
Entry
SELMODRAFT_410685 CDS       T01496                                 

Definition
hypothetical protein
Orthology
K12657  
delta-1-pyrroline-5-carboxylate synthetase [EC:2.7.2.11 1.2.1.41]
Organism
smo  Selaginella moellendorffii
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:smo01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:smo00330]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 771 aa AA seqDB search
MRQQIDPSREFTRDVRRVIVKVGTSVVTRPDGKLAVGRLGALCEQVKDIMDDHIEVIVVT
SGAVAVGRQKLRQQRMMNSRQVRRVIHHFCFLLVCLDLQKPQAELSGKACAAIGQAGLMA
LYDSIFSQLDVASSQLLVTDREFIDPEFRKQLCETVDTLLQLRVVPIFNENDAMSTRRAP
YKDSSGIFWDNDSLAALLALELKVDLLILLSDVEGLYTGPPSDPSSKLISTYIPAQHETI
TFGEKSRYGRGGMTTKVTAAREVASAGIPVVITSGYTPDGFHRVLRGDSIGTLFHKDAHI
WTLTINNDARLMAVAARDSSRRLQSLTSGERQNILYDVADALERNEETIRSENQADVRLA
EELGIAKPLLSRLTLKPGKIADLAKAVRALADMREPIGSILQRTEVAENLTLDKTSCPLG
VILVIFESRPDALVQIASLAIKSGNGLLLKGGKEAARSNAILHKVITEALPKSVGKELIG
LVTSRDEIPDLLKLDDVIDLVIPRGSNKLVSQIKESTKIPVLGHADGICHVYVDKAARLD
VATKIAIDSKVDYPAACNAMETLLVHEDLVDTGGLETLASALKSAGVTLNGGERASKLLN
IPKMTKFHHEYSGLACTVEVVKDVHAAINHIHEHGSAHTDCIVTEDKEVAELFLQQLDSA
AVFHNASTRFSDGTRFGLGAEVGISTSRIHARGPVGVEGLLTTRWLLRGNGQVVQGDRGV
VYTHKDVEVDSMEGWTSMGNGLPASVNGGSLKKSASPFLGSVLAPSVDAAT
NT seq 2316 nt NT seq  +upstreamnt  +downstreamnt
atgaggcagcagatcgatccatcgcgggaattcacgagggatgtgcgacgcgtgattgtc
aaggttggaacgtcggtcgtgacgcggccggatgggaagctcgctgttggccggcttggt
gcattgtgcgagcaagtgaaggacattatggatgatcatatcgaggtgatcgttgtaacc
tctggtgctgtggctgtcgggcgtcagaagcttcgacagcagcgcatgatgaacagcagg
caagtcagaagagtcattcaccacttctgcttccttttggtttgtttagatctgcaaaag
cctcaagccgagttgagcggaaaagcttgtgctgccatcggtcaggccgggctgatggct
ttgtacgatagtattttcagccagctggatgttgcttcgtcgcagctccttgtgacggac
agggaatttattgatcccgagtttagaaagcagctctgtgagactgtcgatacgttgttg
caactacgggttgtgccgatttttaacgagaacgatgcaatgagtacgaggagagctcca
tacaaggattcttcgggtatcttttgggacaacgatagcctggcggctttgttggctctg
gaactaaaagtggatctgctaatcctgctgagtgacgttgagggtctttacacgggacct
ccttccgatccttcctcgaaattgatcagcacgtacattcctgctcaacacgaaaccatc
acttttggcgagaagtcaaggtatggtagaggagggatgacgaccaaggtgactgctgcg
agggaagttgcatctgctggtattccggttgttattaccagtggatacactccagacgga
tttcacagggttttgaggggggattctattgggaccttgtttcataaggatgcacatatt
tggactcttacgataaataatgatgcccggttgatggctgtggctgcaagggattcaagt
cggcgcttgcagagtctcacgtccggggagcgtcaaaacattttgtacgacgttgcagac
gcgctcgagagaaacgaagagactattcgaagtgagaaccaagcagatgtaaggttggcc
gaagagttgggcatcgcaaagccgctactcagcaggctgactcttaagcctggcaagatt
gctgatttggccaaggcagtccgggccctcgcagatatgagagaaccaattggtagtatt
ttgcagaggactgaagtcgcggagaaccttactttggacaaaacttcctgtcctttgggg
gttatacttgttattttcgagtctcgtcccgatgcactcgtccagattgcctccctggcc
attaaaagtggaaatggcctgctactcaagggtggtaaagaggctgcccgttctaatgcc
atactgcacaaggtgattacggaggcgctgccaaagtctgtgggaaaagagctcattggt
cttgttacgtcgagggatgagataccagatcttctcaagcttgacgatgttattgacctc
gttataccaagaggaagcaataaacttgtttcacaaatcaaggagtctacgaaaattcct
gtgctgggccatgccgatggtatctgccatgtctacgtagacaaggctgcccgtctggac
gtcgctacaaagatcgccattgattctaaagtagattatccagccgcatgcaacgctatg
gaaactctactggtccatgaggatctagttgacactggaggcttggagacgctagcgtcc
gcattgaagtctgcaggagtgacactaaatggtggggaaagagcgtcaaagcttctcaac
attccgaaaatgaccaagttccaccatgaatacagtggattagcatgcaccgtggaggtc
gtaaaagacgttcacgccgccataaatcacattcacgaacacgggagtgcccacaccgac
tgcatagtaacggaggacaaggaagtcgcggagctattcttgcaacaattggacagtgct
gcagtcttccacaacgcaagcacccggttttcggacgggacacgctttggtctcggagcg
gaggttggaatcagcacaagccggatccacgcaagagggcctgttggcgtagagggtctt
ctcacaactcgctggttgctacgagggaacggtcaggtcgtccaaggcgaccggggagtt
gtttacacgcacaaggacgtagaggtggactccatggagggatggacgagcatgggcaat
ggactcccggcgagtgtcaatggcggatcgctaaagaagagcgcgtctccatttctggga
tcggttcttgcgccgtccgtcgacgctgccacttga

DBGET integrated database retrieval system