KEGG   Selaginella moellendorffii: SELMODRAFT_410685Help
Entry
SELMODRAFT_410685 CDS       T01496                                 

Definition
(RefSeq) hypothetical protein
  KO
K12657  delta-1-pyrroline-5-carboxylate synthetase [EC:2.7.2.11 1.2.1.41]
Organism
smo  Selaginella moellendorffii
Pathway
smo00330  Arginine and proline metabolism
smo01100  Metabolic pathways
smo01110  Biosynthesis of secondary metabolites
smo01230  Biosynthesis of amino acids
Module
smo_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:smo00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    SELMODRAFT_410685
Enzymes [BR:smo01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.41  glutamate-5-semialdehyde dehydrogenase
     SELMODRAFT_410685
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     SELMODRAFT_410685
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AA_kinase Aldedh
Motif
Other DBs
NCBI-GeneID: 9646044
NCBI-ProteinID: XP_002970003
JGI: 410685
UniProt: D8RFI6
Position
Unknown
AA seq 771 aa AA seqDB search
MRQQIDPSREFTRDVRRVIVKVGTSVVTRPDGKLAVGRLGALCEQVKDIMDDHIEVIVVT
SGAVAVGRQKLRQQRMMNSRQVRRVIHHFCFLLVCLDLQKPQAELSGKACAAIGQAGLMA
LYDSIFSQLDVASSQLLVTDREFIDPEFRKQLCETVDTLLQLRVVPIFNENDAMSTRRAP
YKDSSGIFWDNDSLAALLALELKVDLLILLSDVEGLYTGPPSDPSSKLISTYIPAQHETI
TFGEKSRYGRGGMTTKVTAAREVASAGIPVVITSGYTPDGFHRVLRGDSIGTLFHKDAHI
WTLTINNDARLMAVAARDSSRRLQSLTSGERQNILYDVADALERNEETIRSENQADVRLA
EELGIAKPLLSRLTLKPGKIADLAKAVRALADMREPIGSILQRTEVAENLTLDKTSCPLG
VILVIFESRPDALVQIASLAIKSGNGLLLKGGKEAARSNAILHKVITEALPKSVGKELIG
LVTSRDEIPDLLKLDDVIDLVIPRGSNKLVSQIKESTKIPVLGHADGICHVYVDKAARLD
VATKIAIDSKVDYPAACNAMETLLVHEDLVDTGGLETLASALKSAGVTLNGGERASKLLN
IPKMTKFHHEYSGLACTVEVVKDVHAAINHIHEHGSAHTDCIVTEDKEVAELFLQQLDSA
AVFHNASTRFSDGTRFGLGAEVGISTSRIHARGPVGVEGLLTTRWLLRGNGQVVQGDRGV
VYTHKDVEVDSMEGWTSMGNGLPASVNGGSLKKSASPFLGSVLAPSVDAAT
NT seq 2316 nt NT seq  +upstreamnt  +downstreamnt
atgaggcagcagatcgatccatcgcgggaattcacgagggatgtgcgacgcgtgattgtc
aaggttggaacgtcggtcgtgacgcggccggatgggaagctcgctgttggccggcttggt
gcattgtgcgagcaagtgaaggacattatggatgatcatatcgaggtgatcgttgtaacc
tctggtgctgtggctgtcgggcgtcagaagcttcgacagcagcgcatgatgaacagcagg
caagtcagaagagtcattcaccacttctgcttccttttggtttgtttagatctgcaaaag
cctcaagccgagttgagcggaaaagcttgtgctgccatcggtcaggccgggctgatggct
ttgtacgatagtattttcagccagctggatgttgcttcgtcgcagctccttgtgacggac
agggaatttattgatcccgagtttagaaagcagctctgtgagactgtcgatacgttgttg
caactacgggttgtgccgatttttaacgagaacgatgcaatgagtacgaggagagctcca
tacaaggattcttcgggtatcttttgggacaacgatagcctggcggctttgttggctctg
gaactaaaagtggatctgctaatcctgctgagtgacgttgagggtctttacacgggacct
ccttccgatccttcctcgaaattgatcagcacgtacattcctgctcaacacgaaaccatc
acttttggcgagaagtcaaggtatggtagaggagggatgacgaccaaggtgactgctgcg
agggaagttgcatctgctggtattccggttgttattaccagtggatacactccagacgga
tttcacagggttttgaggggggattctattgggaccttgtttcataaggatgcacatatt
tggactcttacgataaataatgatgcccggttgatggctgtggctgcaagggattcaagt
cggcgcttgcagagtctcacgtccggggagcgtcaaaacattttgtacgacgttgcagac
gcgctcgagagaaacgaagagactattcgaagtgagaaccaagcagatgtaaggttggcc
gaagagttgggcatcgcaaagccgctactcagcaggctgactcttaagcctggcaagatt
gctgatttggccaaggcagtccgggccctcgcagatatgagagaaccaattggtagtatt
ttgcagaggactgaagtcgcggagaaccttactttggacaaaacttcctgtcctttgggg
gttatacttgttattttcgagtctcgtcccgatgcactcgtccagattgcctccctggcc
attaaaagtggaaatggcctgctactcaagggtggtaaagaggctgcccgttctaatgcc
atactgcacaaggtgattacggaggcgctgccaaagtctgtgggaaaagagctcattggt
cttgttacgtcgagggatgagataccagatcttctcaagcttgacgatgttattgacctc
gttataccaagaggaagcaataaacttgtttcacaaatcaaggagtctacgaaaattcct
gtgctgggccatgccgatggtatctgccatgtctacgtagacaaggctgcccgtctggac
gtcgctacaaagatcgccattgattctaaagtagattatccagccgcatgcaacgctatg
gaaactctactggtccatgaggatctagttgacactggaggcttggagacgctagcgtcc
gcattgaagtctgcaggagtgacactaaatggtggggaaagagcgtcaaagcttctcaac
attccgaaaatgaccaagttccaccatgaatacagtggattagcatgcaccgtggaggtc
gtaaaagacgttcacgccgccataaatcacattcacgaacacgggagtgcccacaccgac
tgcatagtaacggaggacaaggaagtcgcggagctattcttgcaacaattggacagtgct
gcagtcttccacaacgcaagcacccggttttcggacgggacacgctttggtctcggagcg
gaggttggaatcagcacaagccggatccacgcaagagggcctgttggcgtagagggtctt
ctcacaactcgctggttgctacgagggaacggtcaggtcgtccaaggcgaccggggagtt
gtttacacgcacaaggacgtagaggtggactccatggagggatggacgagcatgggcaat
ggactcccggcgagtgtcaatggcggatcgctaaagaagagcgcgtctccatttctggga
tcggttcttgcgccgtccgtcgacgctgccacttga

DBGET integrated database retrieval system