KEGG   Selaginella moellendorffii: SELMODRAFT_411405Help
Entry
SELMODRAFT_411405 CDS       T01496                                 

Definition
(RefSeq) hypothetical protein
  KO
K08738  cytochrome c
Organism
smo  Selaginella moellendorffii
SSDB OrthologParalogGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550 Cytochrome-c551
Motif
Other DBs
NCBI-GeneID: 9632713
NCBI-ProteinID: XP_002970800
JGI: 411405
UniProt: D8RHT8
Position
Unknown
AA seq 111 aa AA seqDB search
MATFKDAPAGNAASGEKLFKTKCSACHTIEKGGGHKQGPNLNGVVGRVSGTAPGFSFSQA
NRNAKVTWKDDTLYDYLLNPKKFMPGNKMVFPGLKKPQDRADLIAYLKKSG
NT seq 336 nt NT seq  +upstreamnt  +downstreamnt
atggcaacttttaaggatgccccagccgggaatgcagcgagtggagaaaagctgtttaag
accaaatgttctgcttgtcacacgattgagaaggggggtggccacaaacaaggcccaaat
ctcaacggagttgttgggcgagtttctgggacagctcctggtttttctttctctcaggca
aacaggaatgcgaaggttacctggaaggacgatacgttatatgactatcttttgaatccc
aagaagtttatgccagggaacaagatggtttttcctggattaaagaaacctcaagacagg
gccgatttaatagcatacttaaagaaatccggataa

DBGET integrated database retrieval system