KEGG   Selaginella moellendorffii: SELMODRAFT_413509Help
Entry
SELMODRAFT_413509 CDS       T01496                                 

Gene name
TOR-1
Definition
hypothetical protein
Orthology
K07203  
FKBP12-rapamycin complex-associated protein
Organism
smo  Selaginella moellendorffii
Brite
Protein kinases [BR:smo01001]
 Serine/threonine protein kinases: Atypical group
  PIKK family [OT]
   SELMODRAFT_413509 (TOR-1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 2298 aa AA seqDB search
MAGAQGVAPRPPDALQRLLSELRFKTASIKDGAAAAALRKHVQEEARDLSAEGLTKFLDI
LYDRINCLIESADVSDNLGALRAIDVLIDVELGESATKTMKFANCVKRVLEEKQDPDVLV
RASEVLGHIVSTGPQTADIVESQVSCALKWLRGESRRFAAVLILKEMADQAPTVFNVHVP
EFVDAIWIALRDPRQAIREHAVEALRACLTVIVTRETRWRVRWYYRMFEATQDGLGKNAT
VESIHGSLLAVGELLRNTGEFMMSRYKEVLDIAFKFRDHRDRLVRRSITSLLPRIAHFLR
DRFVTSYFTTSMDHLLAVMRNPSERSTGFAALGEMAGAVGCALGEYLPAIMNFIRDALQP
RRGKPSMEAIACVGNLTEALGPLMEEHVRSTLDIMFDTGLTPTLEKALNQIVTSLPSFLP
PIQERLLDFISLVLCKAPYFSQRKSLLVRLPQKAVGLPSSEIQGPALVQLALKILTNFNF
KGHDLLEFAREAVVMHLEDDDAGVRRHAARCCCRLVEHSYQTAITGRSASRLTSGRPLTF
RKHRILIEEILEKLLVAAVSDTDASVREDVFVSLGTNGSFYDFLAQADCLKAIFIAFNDQ
SFEVRKLSIVMAGKLSDKNAAYVCPALRRHLQQLLTDMEHSADSKSKEESAILLGSLIRA
CETLITPYVIPIHKALVARLSEGSGGSGNIGVVSGVMATVGELARVAGCAIRPHIKDLMP
LIVDALRDTSAASKRDVAVRTLGQLVQNTGYVVTPYTEFPHLLGLLLRILLNGELEWSTR
NEVLKVLGVIGALDPHVNKRNELRLHPSDGNRSSLSETVHGQTNDESLMEAWPTGGISAA
TEDYYSTVKVAINALMRTLRDPSSSIYHQSVVKSLMYICKVMPDLLLTIRNCEDNLREFI
FCQLADLVAIVRQHIRKYLSSILSLVLDMILPTSPRSASHSPILHLVERLCVALHDEFRM
HMPEILPKCIQALNEAERNADYAYVASLLHTFEVFGASLDEHMHLVLPALVRLFKPDVSN
APMDIRRSTIKTFSRLLPCMQVTAHVSSLLHPLLSVLDGTKDELRNDAVDAICVLATVLG
AEFTMFLPSVRKLLQRHHLQHPQFDSIESRLKRRDPILVDVRPTAVSEADIAASSHGAEL
DGENALSTRGTQVNEPHVARELFAVAFVSCWSQLNDSYKKQLVRSLNYALTSPNIPSDIL
GTLLNLAEFMERDEDPLPVDTRTLGSLAEKCHLFAKALHYKEMEFDMVLAREQKHQLVGA
VEALIHVNNQLHQHEAAVGILTYAQRNLGVQLKESWQVFAVATHILQKIMVVGRMRCLVA
LARWEELSTLCRETWSEPSAQLQMAPMAASAAWNMGEWDEMEEYVSQMDNGDEMNVPTRG
QDGTGTGFAGAFFRAVLCIRRSKYDEAGIYAERARKCLATELAALVLESYDRAYSNMVRV
QQLAELEEVIEYCTLQTGNPASEARASLIRRMWRDRIRGAKRNVEVWQRLLSVRTLVLPP
TEDAETWLKFASLCYKSGRYDPEQSDPPPGYVVNPPVMLAYLKYLWSFGEESKRQTAYRR
LQYLALDLANGQASMYCTPQGASGSSGVSPVPLIAPWGKAWHRWALFNTAALSHYSMKGD
SVKAAHHVVSAVSGYFKSIANASTNKGGDDSLQDILRLLTLWFNHGASDEVYAALQDGFK
HVIIDTWLVVLPQIIARIHSHIPAVRELIQQLLVRIGQIHPQALMYPLLVACKSISSSRK
TAALTVVDRVRQHHVALVEQAQLVSQELIRVAILWHEMWYEALEEASRLYFGEHNKEGML
NVLEPLHRKLEEEGAVTLKEIAFAYGRELQEAHEWCMEYRRTGNEAELTQAWDLYYHVFK
RINKQLPSVTTLELQYVSPALLNARNLELAVPGTYRPGPEANVVTIQSFDPQLIVMPSKQ
RPRKCTIKGSDGQDYTFLLKGHEDLRQDERVMQLFGLVNTLLTNARHTAEKDLSIQRYDV
VPLSPNSGLIGWVPNCDTLHHLIREYRDARKVPVNAEHRAMVSFAPDLDHLTLIAKVEVF
QHALEATDGDDLAKVFWLKSKTSEVWLERRTNYTRSLAVMSMVGYLLGLGDRHPSNLMLN
RYSGKILHIDFGDCFEAAMTREKFPEKVPFRLTRMLVKAMEVSGIEGNFRSICEDVMHVL
RSNKDSVMAMMEAFVHDPLINWRLFNINDVPASMATIRAQTATQNLEAVGLPSPPQRGAR
EREMLHAFNVVGQLGDANEVLNERAVSVMGRMSDKLTGRDFPVGESVLSVKDQVQKLIDQ
ATSSENLCQSYVGWCPFW
NT seq 6897 nt NT seq  +upstreamnt  +downstreamnt
atggcaggcgcccaaggcgtggcgcctcggcctccagatgcgctgcagcgccttctatcc
gagctacgtttcaagacagcgtcgatcaaggatggagctgccgctgcagccctgcgcaag
cacgttcaggaggaggcgcgcgacctctctgccgagggcctgacgaaattcctagatatt
ctgtacgatcgcatcaactgcttgatcgagagcgccgatgtaagtgacaatctgggcgca
ttgcgagcaatcgacgtgctcatcgatgtggagctcggggagagcgcaaccaagacgatg
aagtttgcgaattgcgttaagcgagtgctcgaagagaagcaagatcccgacgttctcgtg
cgtgctagtgaagttcttggacatattgtgagcacgggtcctcaaacagctgacattgtt
gagtctcaggtgtcatgcgcattgaaatggctgagaggagaatctcgacgctttgcggca
gttctaattctaaaggagatggcagatcaagcgccgactgtgtttaatgttcatgttcct
gaatttgtcgacgctatttggattgccttgcgtgatcctaggcaagctattcgtgaacat
gctgtagaagctcttcgggcatgtctgacggtgatagtaacacgggaaacaagatggaga
gtgcgatggtactatcgaatgtttgaggctacgcaagatggcctagggaaaaatgctact
gtcgaaagtatccacgggtcgctgcttgctgttggagagcttttaaggaacacgggagaa
ttcatgatgtctcgctacaaggaggtgttagacattgcgttcaagtttcgagatcacagg
gaccgtttagtgcgcaggagcatcacatcattgctgccacgcattgcgcattttctacgg
gatagatttgtgacttcctacttcactacgtccatggatcatcttttagctgttatgcgc
aatccaagcgaacgttctactgggtttgctgcactcggagagatggcaggtgctgttgga
tgcgctcttggcgaatatctgccggcgattatgaattttatacgtgatgcactacaacca
cgtcgcggaaaaccatccatggaagctattgcatgcgttgggaacctgactgaagccctt
ggcccgcttatggaagagcacgttcgcagtacgctggatattatgttcgataccggcctt
actccaacgctggagaaggccttaaatcagatagtgacaagcttgccgtcctttttacct
ccaattcaggagcgcttactggatttcatttccttggttttgtgcaaagcgccatatttt
tcgcaaagaaaaagtcttcttgttcgactgccacagaaggcggtggggcttccttcttca
gaaattcaagggcccgcactggtgcagctcgcgcttaaaattttgaccaattttaatttc
aaggggcatgatttacttgagttcgcgcgagaagcagttgttatgcacctcgaagatgat
gatgctggtgtccgacgtcacgctgctagatgctgctgtcggcttgttgagcattcgtat
caaactgctataactggcagatcagcttccagactcacttctggtcgtcctttaactttt
cgaaagcatcggattctcatcgaagagattctggaaaaacttctagttgctgctgtttct
gatacggatgcttccgtcagagaagatgtttttgtttcgcttggaacgaacgggagcttc
tacgattttcttgctcaggctgactgtttgaaagcaatttttattgcgttcaacgaccag
tcgtttgaagtcagaaaactatccattgtaatggcggggaagctgtcagacaaaaatgct
gcatatgtatgtccggctttgagacgtcacctgcaacagctcttgacagacatggagcac
agcgcggatagcaaaagcaaggaggaaagtgctattctgttgggatcgctgataagagca
tgcgaaactctaataactccttacgttattccgatccataaggctttggtggcgagacta
agtgaaggaagtggaggtagtgggaatattggcgtagtatccggggtaatggcaaccgtg
ggggagcttgctcgagtggctgggtgcgcaataagaccgcatatcaaggacctgatgccg
ttaattgtggatgctcttcgtgacacttctgctgctagtaagcgggatgttgctgtgaga
acactgggtcaactggtccagaacactgggtacgtcgtgacaccgtatacagagtttcca
cacttgctgggtttactacttcgaatattgctgaatggggaactcgaatggtctacaagg
aatgaagttttaaaggtacttggagtcattggtgcgctagatccgcacgtcaacaaacgc
aacgaacttcggctacatccaagcgacggcaatcgctcttctttgtcagaaactgtacac
gggcagacaaatgacgagtctcttatggaagcgtggcctactggtggaatatcggcagct
acagaagattattactcaacagttaaggttgcaatcaatgctctcatgcggactttgcga
gatccctcatcatcgatataccatcaaagcgttgttaaatctcttatgtacatctgcaag
gtcatgccggaccttttgttgaccattagaaactgtgaagataatctacgagaatttatc
ttttgtcagcttgcagaccttgttgcaattgtccgtcagcacattcggaagtatctttca
agcattctttctcttgttctagacatgatccttccgacaagccctcgttccgcttctcac
tcaccaattttgcatcttgtagaaagactctgtgtcgctcttcacgatgagtttcggatg
cacatgccagagattctacctaaatgtattcaagctttgaatgaggctgaacgcaacgct
gactatgcctacgtcgcgtctcttttgcacacttttgaagtatttggcgcttctctggat
gagcacatgcacctagtactacctgccttagtccgcctttttaagccggatgtttcaaat
gcgccgatggatataagacgatctactatcaaaaccttttcacgtcttcttccttgcatg
caggtcactgcacatgtgtcttctttgctacacccgttgttgagcgttctagatggcacg
aaggatgagttgcgtaacgatgctgtggatgctatatgtgttttggctactgtccttgga
gcagaattcaccatgtttcttccttcagtgcgcaagctacttcaacgtcaccacttgcag
catccgcagtttgattccattgaatctcgtcttaaacggcgagacccgatcttggtggat
gtacggcctacagcagtttccgaagcggatatagctgcttcatctcatggagctgaattg
gatggcgaaaatgccttaagtacacggggcacgcaggttaacgagcctcacgtggcacgg
gagttgtttgcagttgcctttgtaagttgctggtcccaacttaatgattcgtacaaaaaa
cagctagtacgaagtttgaattacgctttgacgtctcccaacattccatcagatattctt
ggaactcttctgaatctggcggagtttatggaacgggatgaggaccctctgcctgtggat
acgagaacgcttggcagcttagctgaaaagtgtcatttgtttgcaaaagctttacattac
aaagagatggagtttgatatggtccttgctcgtgaacaaaagcaccagcttgttggagcc
gttgaagctttgattcatgtcaacaaccaactccaccaacatgaggcggctgttggaatt
ttgacatatgcacaacgtaacctcggagttcaactaaaggaatcttggcaagtatttgct
gttgcaacacacatcttacagaaaattatggtcgtaggtcgaatgaggtgcttggtggca
ttggcacgatgggaagagttgagtacactttgcagggagacttggagtgaaccttctgca
cagcttcagatggcaccaatggctgcgagtgctgcatggaatatgggtgaatgggatgaa
atggaagagtacgtgtctcagatggataatggagatgaaatgaacgtacctacgcgaggc
caggacggcactggaaccggatttgcaggggcatttttccgggcggttttatgcattcgg
cgttctaagtacgatgaagcgggcatatatgccgaacgggcacgaaaatgcttagcgaca
gagcttgcggcattggttcttgagagttacgaccgtgcatacagcaacatggtgcgcgtt
caacagttagcagaactggaagaggttatcgaatattgcacactgcaaacggggaaccct
gcatctgaggcacgtgcttcattgatcaggagaatgtggcgggatcgtattcggggagcg
aaaagaaacgttgaggtctggcaaaggttgttatctgttcgaacgcttgtgcttcctcct
accgaagatgccgaaacatggctgaagttcgcttctctttgctataaaagtggccgatac
gatccagaacaaagtgatcctccgcctggctacgtcgttaatcctccagtgatgctggca
tatttaaaatacctttggtctttcggcgaggaatcgaaaaggcaaaccgcctatagacgg
cttcagtatcttgcactagatttggcgaatggccaagcatccatgtactgtacacctcag
ggtgcttctggcagttctggagtgtcgccggttcctctcattgcaccgtgggggaaggct
tggcataggtgggcattgttcaacacggcggccttgtcacattactctatgaaaggagat
tcggtaaaggctgctcatcacgtggtatcagctgtttctggatacttcaaatccattgca
aatgcgtccacgaacaagggcggggatgatagtttacaggatattctacggcttttgacg
ctctggtttaaccatggtgcttccgatgaagtttatgctgcgttgcaagacggttttaag
cacgtgataatcgacacatggctggtggtcctgccgcagattattgctcggatacactcg
cacattcccgctgtccgagagcttatccaacaactccttgtacgcattggacagattcat
cctcaggctcttatgtacccgcttttagttgcatgtaaatccattagctcctcacggaaa
actgctgctttgacagttgttgacagagttcgccagcatcacgtagctcttgtggagcaa
gcacaattagtctctcaggagcttatacgagtggccatactctggcatgaaatgtggtac
gaagcacttgaagaagccagccgtctgtattttggggagcataataaggagggcatgcta
aacgtgctggaacccttgcatcgtaaactagaggaagaaggtgccgtaaccctcaaagag
atcgcattcgcttatgggcgagaattgcaagaagctcatgaatggtgcatggaatatcgt
cgtactggtaatgaagcggaactcacacaggcttgggatctctattatcacgtatttaaa
cgtataaacaagcagcttccaagcgtaactactctggaacttcaatatgtttctcctgct
cttctcaatgctcgcaatttggaacttgctgtccctggaacatatcgtcctggtccggaa
gcgaacgttgtgacaatacagagttttgatccacagctcatagttatgccatcgaaacag
cgacctcggaagtgcaccatcaagggcagcgatggccaggattatacattcttattaaag
ggccatgaagaccttagacaagacgagcgcgtgatgcagttatttgggcttgtaaatacc
cttctaacgaatgcccggcacacggcggagaaggacctttccattcagcgatatgacgtg
gttccgctctctccaaacagcggtcttattggatgggtcccaaactgcgacactctacat
caccttattcgtgaatatcgggatgctcggaaggttcctgtcaatgctgaacatcgagcc
atggtgtcgttcgctcctgatctcgatcatcttactcttatagccaaagtcgaggtattc
cagcatgctctggaggcgaccgacggtgatgacctggcaaaggttttctggcttaaaagc
aaaacctcagaagtttggctagaacggcgaacgaactacactcgtagcttagccgtcatg
agcatggtcggataccttcttggtttaggcgatcgacatccaagcaatctaatgcttaat
cgctacagcgggaaaattctgcacattgactttggggattgcttcgaggcagcgatgacg
cgggagaagtttcctgaaaaggttccatttcgattgacaaggatgctagtaaaggccatg
gaagttagtggcatcgaagggaacttccggtcgatttgcgaggacgtgatgcacgtcttg
agatcaaacaaagacagcgtaatggccatgatggaggcatttgttcacgatcctttgatc
aactggaggctgtttaacatcaacgacgtaccagccagcatggcaaccatccgtgctcaa
acagcgacccaaaacttggaggcagtaggactgccttctccacctcaaaggggagctcgg
gaacgcgagatgcttcacgcattcaacgtggttggacaactcggggatgcaaacgaagta
ctcaacgaacgggctgtgtccgtgatggggaggatgagcgacaaactcacgggtagagac
tttcctgtgggagagtcggttcttagcgtcaaagaccaagtccagaaactcatcgaccaa
gctacttccagcgagaatttgtgccaaagctatgtggggtggtgcccattttggtag

DBGET integrated database retrieval system