KEGG   Selaginella moellendorffii: SELMODRAFT_414775Help
Entry
SELMODRAFT_414775 CDS       T01496                                 

Definition
hypothetical protein
Organism
smo  Selaginella moellendorffii
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 364 aa AA seqDB search
MGATGSKLEKALGDQFPEGERYFGLENFGNTCYCNSVLQALYFCIPFRDQLLDYYGRIKT
VGEAEENLLTCLADLFTQINSQKKKTGVIAPKRFVQRVKKQHELFRSYMHQDAHEFLNFL
LNQLVEALEKEAKSDPTAPASPEKKSSDNGATGEEHPLTWVHKIFQGCLTNETRCLRCET
ITAKDEKFLDLSLDIEQNSSVTSCLRNFSSTETLIADDKFFCDKCCSLQEAQKRMKIKTQ
PRILALHLKRFKYMEQLGRYKKLSYRVVFPLELKLCNTAEDAPGSESEYSLFAVVVHVGS
GPNHGHYVSLVKSHNHWLFFDDENVEMIDESYVQTFFGSTQEYSNNTDHGYILFYECLDP
AKAS
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgggagccacgggctccaagctcgagaaggcgctgggcgatcagttcccggagggtgag
cgctatttcggcctggagaatttcggcaatacttgctactgcaatagcgtattacaggca
ttgtacttttgcatcccattcagggaccagctgctggattactacggtcgaatcaagacg
gtcggagaagccgaagagaatttactgacttgcttagcggatctcttcacacagataaac
tctcaaaagaagaagacgggtgttatagctccaaagagattcgtgcagagggtaaagaag
cagcacgagctcttccggagctacatgcaccaggacgcacacgagtttctaaactttttg
ctgaatcaactagttgaagctctggagaaggaggccaagtcggacccgacagccccagca
tccccagagaaaaagtctagcgataatggagcaactggagaagagcatccgcttacgtgg
gtccacaaaatcttccaggggtgtctcaccaacgagacgaggtgcctgcgctgcgagacg
ataacagcaaaggacgagaagttcctcgatctcagcctcgacatcgagcagaacagctcc
gtcacaagctgcctccgcaacttcagctccaccgagacgctcatcgccgatgacaagttc
ttttgcgacaaatgctgcagcttgcaggaagcgcaaaagcggatgaagatcaagacgcag
cctcgcatcctcgcgctccacctcaagcgcttcaagtacatggaacagctgggccgatac
aagaagctctcgtacagggtggtgttcccgctggagctgaagctgtgcaacacggccgag
gatgctccggggtccgagtcggagtactcgctgttcgcagtggtggtgcacgtagggagc
ggccccaaccacggccactacgtgagcctggtcaagagccacaaccactggctgttcttc
gacgacgagaacgtagagatgatcgacgagagttatgtgcaaacgttcttcggctccacg
caggagtactccaacaacacagaccacggctacatcctcttctatgagtgcctggatccc
gcaaaggcatcgtga

DBGET integrated database retrieval system