KEGG   Selaginella moellendorffii: SELMODRAFT_419389Help
Entry
SELMODRAFT_419389 CDS       T01496                                 

Definition
hypothetical protein
Orthology
K03259  
translation initiation factor 4E
Organism
smo  Selaginella moellendorffii
Pathway
RNA transport
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:smo00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    SELMODRAFT_419389
Translation factors [BR:smo03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    SELMODRAFT_419389
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 209 aa AA seqDB search
MALEGSSDEEELRRLRDADDKERHIRAGLHPLQQRFVFWYTRRTPGVRSHISYEDSMKKI
AEFSTVEGFWSCYCHLSRPSNCPNPTDFHLFKEGIRPLWEDTANRNGGKWIVRFKKIVSG
RFWEDLVLAMIGDQLDYSDSVCGAVLSIRFGEDILSVWNRNASDNQAVMALRDSIKRHLH
LPTSYVMEYKPHDASLRDNSSFRNAWLRG
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atggcgctggaagggagtagcgacgaggaggagcttcgtcgattgcgcgacgccgatgac
aaggagcgccacattcgcgccggcttgcatccgctccagcaacgctttgtgttttggtac
acgaggaggactccgggcgtgcgctctcatatttcttatgaggacagtatgaagaagatc
gctgagtttagcactgttgagggattttggagctgctactgccatctctcgaggccatcc
aattgtccaaatcccactgactttcatctcttcaaagagggaataagaccactgtgggag
gatactgcaaatcgaaacggtggaaaatggattgttcgctttaagaagatcgtatccggt
cgattctgggaggacttggtgctcgcaatgatcggagatcaactcgactacagtgacagc
gtctgtggagcggtgctgagcattcgtttcggggaggacattttgagcgtctggaatagg
aacgcgtctgataatcaggctgtgatggctcttcgcgattccatcaagcggcacctccat
ctccccaccagttacgtgatggagtacaaaccacacgacgcttccttgcgagacaactcg
tccttcagaaacgcatggcttcgagggtga

DBGET integrated database retrieval system