KEGG   Selaginella moellendorffii: SELMODRAFT_420727Help
Entry
SELMODRAFT_420727 CDS       T01496                                 

Definition
(RefSeq) hypothetical protein
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
smo  Selaginella moellendorffii
Pathway
smo00630  Glyoxylate and dicarboxylate metabolism
smo01100  Metabolic pathways
smo01110  Biosynthesis of secondary metabolites
smo01200  Carbon metabolism
Module
smo_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:smo00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    SELMODRAFT_420727
Enzymes [BR:smo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     SELMODRAFT_420727
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-GeneID: 9647027
NCBI-ProteinID: XP_002981082
JGI: 420727
UniProt: D8SCX4
Position
Unknown
AA seq 566 aa AA seqDB search
MEFGRATRVVDEEAEFEAEAAAVEAWWRSDRFRLTRRPYTARDVARLRGTLPIHYPSNEM
AKKLWFILKNHQANKSCSRTFGALDPVQVAQMAKYLDTIYVSGWQCASTASTSNEPGPDL
ADYPMDTVPNKVEHLFMAQLFHDRKQREARLSVGKEIRSRTPYVDYLAPLIADADTGFGG
TTATVKLVKMFVERGAAGIHMEDQASVTKKCGHMGGKVLVATSEHINRLVAARLQLDVMG
VEQILVARSDSVAATLLQSNIDPRDHYFILGASNPAVKGKPLVTVMAEAQAMNKSGNELQ
AIEDNWLAQADLRLFSDVVADAIRKMNIAENVKVARLNRWFDSVEGLSHADARALAATLG
VTDVFWCWDLPRTREGFYRFQGSTKACIARGCAFAPYADLLWMETATPDVVQAQDFAEGV
KAKHPEIMLAYNLSPSFNWDAAGMNDAQMQEFIPHLARMGYCWQFITLAGFHANSLAADT
FARDFKQRGMLAYVEDIQRQERMNNVETLAHQTWSGANYYDQLLKTVTGGVSSTAAMQKG
VTEDQFKDTFGSNLQAGAEVFAKSKL
NT seq 1701 nt NT seq  +upstreamnt  +downstreamnt
atggagtttgggagagcaaccagagtggtcgacgaggaggccgaattcgaggcggaggcg
gccgcggtggaggcatggtggcgatccgatcgcttccgcctcacgcgacgcccctacacc
gcccgcgacgttgcccgcctccgcgggactctcccaatccactacccctccaacgagatg
gccaagaagctgtggttcatcctcaagaaccaccaggccaacaagtcgtgctcccggacc
tttggagctctcgatccagtccaagtcgcccagatggccaagtacctcgacaccatctac
gtctcgggctggcagtgcgcatccaccgcctccacctccaacgagcccggccccgatctc
gccgactatcccatggacaccgtcccaaacaaagtggagcatctcttcatggcgcagctc
ttccacgatcgcaagcagcgggaggctcggctgagcgtcggcaaggagatccgatccagg
accccctacgtcgactatctcgcgcctctcatcgccgacgctgacactggattcggcggc
accaccgccactgtgaagctcgtcaagatgttcgtggagcgcggagccgccgggatccat
atggaagaccaagcctcggtgacgaagaagtgtggtcatatgggtggcaaagttctcgtc
gccacctccgagcatatcaatcgtctcgtcgctgcgaggcttcagctggacgtgatggga
gtggagcaaatcctggtggcgaggtccgactcggtggctgcgacgctgctccagagcaac
atcgatccccgagaccattacttcatcctcggtgcgagcaatccggctgtcaaaggcaag
ccgctcgtcacggtcatggccgaggcccaggcgatgaacaagtccgggaacgagctccag
gcgatcgaggacaactggttggcgcaggcggacctccggctcttctcggacgtggtcgcg
gacgccatccggaagatgaacattgccgagaatgtcaaggtggcgaggctgaatcgctgg
tttgacagcgtcgaggggctctcccatgctgatgctcgagctctggctgccactctcggc
gtcaccgacgtcttctggtgctgggatcttccgagaactcgggaaggattctaccgcttc
caggggagcaccaaagcttgcatcgctcgaggctgcgcctttgctccctatgccgatctt
ctctggatggagactgctactccggacgtcgtccaggctcaagactttgccgaaggtgtc
aaggccaagcacccggagatcatgctcgcgtataacttgtcaccgtctttcaactgggac
gctgccgggatgaacgacgctcaaatgcaagagttcatcccccacctggcgaggatggga
tactgctggcagttcatcactttggctggtttccacgcgaattctctggctgctgatacg
tttgctcgtgacttcaagcagcgtggcatgctggcttacgtcgaggatatccagcgccag
gagcgtatgaacaacgtcgaaactctggctcatcagacctggtccggggcgaattactac
gaccagctgctcaagacggttactggcggtgtctcgtccactgcggcgatgcagaaaggt
gtgaccgaggaccaattcaaggatactttcggaagcaacttgcaagccggagcggaagtg
ttcgccaagtccaagctgtga

DBGET integrated database retrieval system