KEGG   Selaginella moellendorffii: SELMODRAFT_421707Help
Entry
SELMODRAFT_421707 CDS       T01496                                 

Definition
hypothetical protein
Orthology
K10877  
DNA repair and recombination protein RAD54B [EC:3.6.4.-]
Organism
smo  Selaginella moellendorffii
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:smo00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    SELMODRAFT_421707
Enzymes [BR:smo01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.-  
     SELMODRAFT_421707
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 825 aa AA seqDB search
MEVIEVENAWPDVDGFHTRIVMETSAIKPPLPLRPALCGDMDPDRSLLSLGGSDFSGGSS
SISRKSVSGASSASKKLCVEVPWRYFEVMYSVKKKNSRKPGPRSDGVLAVQGSSYNLLDN
NGKSISKRKISGKEIKENSSLEVFNFVIEVLDEIPEEEYLSGKIFSTSRPTFPSSEGSDI
TVESARNPGRERLSRPMQILEKDQLVLNMAEVANGAAPVVVDPYIASKLRPHQREGVKFM
YECVMGLRSRTFTGCLLADEMGLGKTVQVIALIWTLLRQGSGGVPAVRRAAVVCPLTLTR
NWGKEVRKWLGSERLKAMVVDCAREAAEKIIDFKNDSFCPLLITSYEILRKHKDIVASTN
LELLICDEAHRLKSCENNQWLSKGNKTIASLASLNCNKRILLVRFCSLHGFLTPGSDWQT
GTPAQNNLSEFYALLDFANPELLGSYNEYKNIYASPIEQSRDRNASHAEKELGSERSEEL
KQMTSFCILRRTSEINKEHLPPKSEYAVFCKLHDVQISLYEIFVKSQFVRTMLNSDIQRA
HVLSAIGALRKLSSHPGLLQSDMKHVTSAEIKNQPFFHRAEELLDLSDVQASLRDVVRHN
WSLSGKFVCLQHLLLATIQCNDRIVVASNFTQTLDLIEAMCNEHSWKFVRLDGGTMISER
QPLVERLVLVDPDWNPANDAQVMSRIWREGQPKPVKIYRLLSTGSIEEKIYQRQIMKKDL
TSFFGDQSTYQPTCKRTNDQKFSRQELRELLKLPSETKCETYDLLCRLNTQLEDKWKDSS
GMLDDHVLQSAVESGVTTFVSADSPQTQQSSGVLERDTGLDCGAC
NT seq 2478 nt NT seq  +upstreamnt  +downstreamnt
atggaagtgattgaggtggagaacgcctggccggacgtggacggattccacacgcgcatt
gtgatggagacgagcgctatcaagccgccgctcccgctcaggccggcgctgtgcggggat
atggatccggatcgatcgctgctctctctcggcggcagcgattttagcggtggtagcagc
tcgatctcgcggaaatccgtgtcgggagcgtcttcggcgtccaagaagctctgcgtcgag
gtgccatggcgatatttcgaggtcatgtacagcgtcaagaagaaaaactccaggaagcca
gggccgcgatccgatggcgttcttgcggtccagggatcgagctacaatctgctcgacaat
aacggcaagtcgatcagcaaaagaaagatttcgggaaaagaaatcaaagagaattcttct
ctcgaggttttcaactttgtgatcgaagtattggacgagatccccgaggaagagtacctg
agcgggaagatcttctcaacgagcaggcctacctttccttcttccgaaggatcggacatt
actgtcgagtccgctcggaatcctggaagagaaaggctgtctaggccaatgcagattctg
gagaaagaccagcttgtcctcaacatggcagaagttgcaaatggcgctgctccagtcgtt
gttgatccatacatcgcttcaaaacttcgaccgcaccagagggagggagtgaagtttatg
tacgagtgcgtcatgggactgagatctcgcacatttactggctgtctactagctgacgaa
atgggtctcgggaaaactgtgcaagtcattgcactgatttggacgctgcttcgtcagggt
tctggaggagttcccgctgtaaggcgagcagcagttgtttgcccgttgacgctaacccga
aattggggaaaagaggtgcgtaagtggctgggctcggaaaggttgaaagcaatggtcgtc
gactgcgcaagagaggcagcagaaaagataatcgacttcaaaaacgacagcttctgtcct
cttttaatcacgtcgtatgaaatactaaggaagcacaaggatattgttgcctcgacgaat
cttgagcttcttatctgcgatgaagctcatcgactgaaaagctgcgagaacaaccaatgg
ctcagcaagggaaacaaaacgattgcgtcactggcgtcgttgaactgcaacaagaggatt
ttactcgtaagattttgtagccttcacggctttctaacgcctggctctgactggcagact
ggaacacccgcccagaacaacttaagcgagttttatgctttgcttgattttgccaatcca
gagctattgggttcctacaacgagtataagaatatctacgcttctcccattgagcaaagt
cgggatcgcaacgccagccacgctgagaaagaattaggctcagagagatcggaagagcta
aaacaaatgacaagcttttgcattcttcgaaggacatctgagataaacaaggagcacctt
ccaccgaaatcagagtacgccgtgttttgcaaacttcacgatgttcagattagtctttac
gagatatttgtcaagtctcagttcgtacgaaccatgctaaactcagatattcaacgtgcg
cacgttctttctgcaattggagcgctgcgtaaactttcaagccatccggggctgctacag
agtgatatgaagcacgttacgagcgcggaaattaagaatcaaccattttttcatcgcgcc
gaagaattgcttgatctttctgatgtccaagcatccttgagagatgtcgtgaggcacaat
tggagcctatctggaaagttcgtgtgcttacaacatcttcttttagcgactatacaatgc
aacgacagaattgtggtcgcttccaacttcacacaaaccttggacttgatagaggcaatg
tgcaatgaacactcatggaagttcgttcgactggacggtggaaccatgatatcggaaaga
cagccactcgtcgaacggctcgttttagtcgatccagattggaatccagcaaatgacgcg
caggtgatgagtcgaatatggagagaaggccagccgaaaccagtaaaaatatacaggctt
ctgtccactggcagcatcgaggagaagatatatcaacggcaaatcatgaaaaaagatctg
acgtctttctttggtgatcagtccacatatcaacctacctgtaaaagaacgaacgaccag
aagtttagccggcaggaactcagagagcttttgaaattgccttcggaaacaaaatgcgag
acatatgatctactgtgccggctcaacacgcaactggaggacaaatggaaagactcgtca
ggaatgctggatgaccacgtcttacagagcgcggtcgaatcgggagtgactacgttcgtg
tcagctgactcgcctcaaacgcaacaaagcagcggagttctcgaaagagacacaggcttg
gattgtggagcatgttaa

DBGET integrated database retrieval system