KEGG   Selaginella moellendorffii: SELMODRAFT_422791Help
Entry
SELMODRAFT_422791 CDS       T01496                                 

Definition
(RefSeq) hypothetical protein
  KO
K09580  protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
smo  Selaginella moellendorffii
Pathway
smo04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:smo00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    SELMODRAFT_422791
Enzymes [BR:smo01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     SELMODRAFT_422791
Chaperones and folding catalysts [BR:smo03110]
 Protein folding catalysts
  Protein disulfide isomerase
   SELMODRAFT_422791
Membrane trafficking [BR:smo04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    SELMODRAFT_422791
Exosome [BR:smo04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   SELMODRAFT_422791
  Exosomal proteins of colorectal cancer cells
   SELMODRAFT_422791
  Exosomal proteins of bladder cancer cells
   SELMODRAFT_422791
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thioredoxin Thioredoxin_6 Thioredoxin_7 Thioredoxin_8 Thioredoxin_2 OST3_OST6 AhpC-TSA ERp29_N Thioredoxin_3 Redoxin TraF
Motif
Other DBs
NCBI-GeneID: 9654957
NCBI-ProteinID: XP_002983470
JGI: 422791
UniProt: D8SJJ7
Position
Unknown
AA seq 555 aa AA seqDB search
MARNRHLFLALLLAALLACASFIQVHSEDADDLEDLDAEDEPQHKAAAHDLAEEGPEEED
YGSWEDEQYPAVDDKDVVVLGSGNFSDFIKKNKFVMVEFYAPWCGHCQQLAPEYADAATK
LKGEVALAKVDATVEHDLSQEHEVQGFPTIFFFVDGVKRSYSGHRTGDEIIKWIKKRTGP
AVTNVDSVSDAETILAAGSPIAVAFLSSLEGAEAEEFAAAARQDDNVLFYQTTKAEVAER
FELKRKKSPAVVLLKKEHETTSHFDGKFEKDAISQFVSTNKLPLVIVFSGENSSLIFDNP
IKKQLLLFAGGEDFKSLYPSYQSAAKALQGKHLVGQLIFVHVDTAGEDAAQITEYFGITA
EKPKVMGFSPDEQRKFMLDKDITTDNLKAFGEDFLADKLQQFYKSEPVPEKNDGDVKIVV
GSNFDEIVLDESKDVLLEIYAPWCGHCQALEPIYNKLAARLREVKSLVIAKMDGTANEHH
RAKSDGFPTLLFFPANKKSFDPITVDADRSVKAFYQFLKKNAAIPFTLPKSEKTKSQAPE
EAAAPPKKEELKDEL
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atggcaagaaaccggcatttgttcttggcgctcctcctcgcggcactgctggcatgcgcg
agcttcatccaggtacattccgaggatgccgacgatctggaagatctggacgccgaggac
gagccgcagcacaaggccgctgctcacgatcttgccgaggaggggcccgaggaggaggat
tatggatcctgggaggacgagcagtatccagccgtggacgataaggacgtggtggtgctc
ggcagcggcaacttcagcgatttcatcaagaagaacaagttcgtgatggtggagttttat
gctccgtggtgtggccactgccagcagctagctccagagtacgccgacgccgccaccaag
ctcaaaggtgaagtggctcttgccaaagtagacgctaccgtggagcacgacttgtcccag
gagcatgaggtacaaggatttccaaccatcttcttcttcgtggatggtgtgaagcgctca
tactcggggcaccggactggggatgagatcattaagtggataaagaagaggaccgggcct
gctgttacaaatgtggattctgtttctgatgccgagacgattctagcagctggaagccca
atcgctgtcgctttcttgagcagcttggagggtgctgaagccgaggagttcgctgctgct
gcacgtcaagacgataatgtgttgttctatcaaactacgaaggcagaagttgcggaacga
tttgaactgaaaaggaagaagagcccagcggtggttcttctgaaaaaggagcacgagaca
acttctcactttgatggcaagttcgagaaagatgcaatctcacagttcgtctcaacaaat
aaattgcctttggttattgtttttagtggggagaattctagtttgatatttgacaacccg
ataaagaaacagcttctcctttttgctggtggcgaagatttcaaatcgttgtatccttcg
tatcaatctgcggcaaaagcattacaaggaaagcatctggtgggacagcttatttttgtt
catgttgacactgcgggagaggatgcggcacagatcactgagtattttggtatcaccgct
gagaagccgaaggtgatgggattttctccggacgagcaacgaaagtttatgttggataag
gatatcaccacagataacctcaaggcttttggtgaggactttctggcagataagcttcag
caattctataaatctgaaccagtaccagagaagaatgatggagatgtaaaaatcgtcgtg
ggtagcaacttcgacgagattgttctggacgagtccaaggatgtcttgctggagatttat
gctccgtggtgcgggcattgtcaagcactggagcccatctacaacaagctcgcagctcgg
ctccgagaagtcaaatctctggtgattgccaagatggacggaacagcaaacgaacaccat
cgggcaaagtcggatggttttcccacgctcttgttttttcccgctaacaagaagagcttt
gacccgatcacggtggacgcggacaggagcgtcaaagccttctaccagttcttgaagaag
aacgccgcgatcccattcacgctaccaaaatccgagaagacgaaatctcaagctccagag
gaggcagccgcccctcccaagaaggaggagctcaaggacgagctctaa

DBGET integrated database retrieval system