KEGG   Selaginella moellendorffii: SELMODRAFT_422911Help
Entry
SELMODRAFT_422911 CDS       T01496                                 

Definition
hypothetical protein
Orthology
K04498  
E1A/CREB-binding protein [EC:2.3.1.48]
Organism
smo  Selaginella moellendorffii
Brite
Enzymes [BR:smo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     SELMODRAFT_422911
Transcription factors [BR:smo03000]
 Eukaryotic Type
  Other transcription factors
   Pocket domain CBP
    SELMODRAFT_422911
Mitochondrial biogenesis [BR:smo03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    SELMODRAFT_422911
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 1570 aa AA seqDB search
MQAQAQLSGQCITLQDKTSLPSNPWGNDLALRRKVIEKIAQIFQKCKHQLPPEWQQKIPD
LVSNVEQALYNDATSKEDYADVRTLEHRLQVATHRFVNQQPRVTSIEDLTRSSGTAVSVN
GGGGMVPTPGMGGNLVPTPGYSNTMIPVGGHGNGTARASSTMMPTPGLGNKMGISTNGSM
MPTGNANMNFVANGVQTSTGMFANGNLMPSGMPVNGMRMIHDGQLASSTGFSAGGMQMMP
TPGLSMPQQSPSVSNFPKVSDISMASVQPQQLAASNGHILRAHMNGASQVKTANGLANGM
VMNRSHLANGNVAVHDYPNQAQAQYMLQQQQRLNQQQRMQTLSSAVSNGSYAMNAADLAG
PGGNLYTPSTTGGLVNNGVALNAINPQLAKSSSQQQGVAMSLQQQRMQQQQQHHQKQLQQ
QMQQLQQRQQAAQQQQPQQQDQGTTFQQLSDLTKTSLDVQNVVPGPVVQMEQSDQKPSPQ
VQQTWQAQEREVKNIANENHVVFPETQKQLQTPNSETLQPKPEPVNESVQVTEHQQSPQP
APAVLKQEQGSPSSMVSTPGGAAAQPESNGSGTGPQPVISSTRAQQYLKQQRWLLFLRHA
TKCSAAGGQCICSPHCQTARQLLSHMSKCRDRECQYPRCSASMKLLTHHQSCRDARCPVC
GPVRQAILKQTHPPPADQMGSPPGSKDGGQPPLKRPKVASPDSTTMENGDGPVKVESKEV
IKAVKAEAPHGGGVRNVKPEPVASDVKHPGNAIVKHESGPRIGKGGKPKIVGVSLTEIFT
IEQIKQHIVSLRQWVGQSKSKAEKNQAMELQANEHACRLCAVEKLFFDPPPIYCTSCGIR
VKRNALYYTTAVRETRHYFCIPCYNDVRTENVELEGLTYAKSCLEKRKHDEEQEEAWVCC
DKCNLWQHQTCALFNSRRNEGGEAEYTCPECCMAEMESGERDPLPVSAVLGAKDLPRTWL
SDHLESRLTLKLRQERSERARKEGRSHDEVLGAEGLVVRVVSSVDKRLEVKPRFLEIFQE
EDYSTEFPYKSKAVLLFQKIEGVEVCLFGMYVQEFGVESAQPNQRRVYLSYLDSVKYFRP
AEVKTPNGEALRTFVYHELLIAYLEYCKRRGFTSCYIWACPPLKGEDYILYCHPEIQKTP
KSDKLREWYLTMLRKASRENIVVEITNFYDFFFISPGECKAKVTAARLPYFDGDYWPGAA
EDMILQLQQQDDDDGSKQQKKGKIKKPPTKRATKTAAQAEMAINASKDAQLMQKLGESIM
QMKEDFIMVHLQHTCTHCRNFILTGCRWVCRPCKTFQLCDRCHEAELKLDERERHPVNSK
EMHYLTPIEVTDVPPDTKDNDDLMESEFFDTRHAFLTLCQGNHYQYDTLRRAKHSSMMVL
YHLHNPMAPAFVVTCCICTHDIEPGQGWKCETCTEYDVCNGCYYKEETRKHPHKLVQHPS
ASERNAQNKEARQQRVQQLKMMQELLVHASKCCTTQCQYPNCGDLKRLFRHGMTCQKRVI
GNCLHCKRMWSFMQLHARSCKQADCRVPRCNRWEASSTRNNACFLVSLPRAKVETKRKYQ
TSQGETKMRE
NT seq 4713 nt NT seq  +upstreamnt  +downstreamnt
atgcaggcccaggcacagctatctgggcagtgcatcactttgcaggataagacgtcgtta
ccttcgaatccatggggtaacgatttggctttgcgtaggaaggtcatagaaaaaatagca
cagatttttcagaaatgtaaacaccaattgcctccagagtggcagcagaaaatccctgac
ttggtatcgaatgtggagcaggctttgtacaatgatgctacttctaaggaagattatgct
gacgtgcgaacgttggagcatcgtctccaagttgcaactcatcgatttgtcaaccagcag
ccgcgagtaacttctatagaggatctcacgaggtcttctgggaccgcggtctctgtgaac
ggtggaggtggcatggtaccaactccaggcatgggtggcaaccttgtccctactcctggt
tactcgaacaccatgatcccggttgggggtcatggtaatggtaccgccagggccagctcg
acgatgatgccaactcctggacttggcaacaagatggggatctctacgaacggaagtatg
atgcccaccgggaatgcaaacatgaacttcgtcgccaatggcgttcaaacttcgacaggg
atgtttgccaatgggaacttgatgcctagtgggatgcctgtcaacggtatgaggatgatt
cacgatggacaacttgcctccagtacaggattttcagctgggggaatgcagatgatgccg
acgccgggtctcagcatgccacagcagtcgcccagtgtgtcgaacttccctaaagtcagc
gacatctcgatggcttccgtgcaaccgcagcagctcgcggcttccaatggtcatatcctt
cgtgctcatatgaacggtgcttctcaagtgaagacagcaaacggactagcgaatggtatg
gtgatgaatcgttctcacctagcgaacggaaacgttgcagtgcacgattacccgaatcaa
gctcaagctcagtatatgctacaacagcaacagcgtttgaaccaacaacaacggatgcaa
acgctgagctccgccgtttccaatggcagctatgccatgaatgctgcggacttggctgga
cctgggggtaacttgtatactccatcaacaacaggtggccttgtgaacaatggagttgct
ctaaacgcaattaatcctcaacttgcgaaatcttcgagtcaacagcaaggggtggcgatg
agcttacagcaacagcgaatgcagcagcagcaacagcatcaccagaagcaattgcagcaa
caaatgcagcagctgcagcaaaggcaacaagccgcacaacagcagcagccgcaacagcaa
gatcagggaacaacgttccagcaactctctgacttaaccaagacctcattagacgtccag
aatgttgtcccgggacctgttgttcagatggagcagtcggatcaaaaaccgtccccgcag
gttcagcaaacatggcaggcgcaagagagggaggtgaaaaacatcgccaacgagaatcat
gtcgtgttcccggagacacagaaacagttacaaactccgaatagtgagaccttacaaccg
aagccggagccggtgaacgagagcgtgcaagtgaccgagcaccaacaatcaccacagcct
gctcctgccgttttgaagcaggaacaaggaagtccgtcgtctatggtatcaactccggga
ggagcggctgcccagcctgaaagcaacggctctggaacgggaccccagccagtgatcagc
agtactcgtgctcagcagtacctcaagcagcagcgctggctactttttctccgtcatgca
acgaaatgctccgccgcgggtggacagtgcatatgcagtcctcactgccaaactgctcgc
cagctgctaagtcacatgtccaaatgccgggatcgtgagtgccaatatccgcggtgcagt
gcctcgatgaagttgctcacacaccatcagtcgtgtcgtgacgctagatgcccggtttgt
ggacctgtccggcaggccatcttaaagcaaactcaccctccgccagcagaccagatggga
tctcctccgggttctaaagatggtggccagccacctctgaaacggcccaaggtggcgtcg
ccagactctactactatggagaatggtgatggacccgtcaaggtcgagtcgaaagaggtt
atcaaagctgtgaaggctgaagcacctcatggtggtggcgtccggaacgtgaagccggag
cctgtagcaagtgacgtgaagcatcccgggaacgcgattgttaagcacgagtctggtcca
aggattggcaaaggaggaaagccgaaaatagttggcgtctcgctaacagagatcttcacc
atcgagcaaatcaagcaacacattgtgagcttaagacagtgggttggccagagcaagtcc
aaagcagagaagaaccaggccatggaacttcaggcaaacgagcacgcttgtagattgtgt
gcagttgagaagcttttcttcgatccaccacctatttattgcacgagctgcgggatacga
gtgaagcgaaacgcactctactatacaacagcggttcgtgaaactcgacactacttttgc
attccttgttacaacgatgttcgcacggagaatgtcgaattggaaggccttacgtacgct
aagtcgtgcttggagaaaaggaagcacgacgaagagcaagaagaggcgtgggtgtgctgc
gacaagtgtaacttatggcaacatcaaacctgcgcgcttttcaatagcaggaggaatgag
ggtggagaagcggagtatacttgtcccgagtgctgcatggctgaaatggagtcgggcgaa
agagatccactgccagtctcggctgtcctcggagccaaagaccttcctcggacgtggcta
agcgatcacctcgagtccagactcactctgaagctcaggcaggagcgatctgagcgcgct
agaaaggaagggagaagccatgacgaggttctcggcgcggaggggctggtcgtgagggtt
gtttcctccgtggataaaaggctggaagtcaaacctcggtttctagaaatctttcaagag
gaggattactctactgaattcccgtataaatcaaaggcagtgctactttttcaaaagatt
gaaggagtggaggtttgtctttttggaatgtacgttcaagagtttggagtggagtctgcg
caaccaaatcagcggcgggtgtatctttcttatttggattccgtcaaatacttcagacca
gcagaggtgaaaacaccaaacggagaggcactaagaactttcgtttatcatgaattgctg
attgcttacttggagtattgtaaaaggagaggttttaccagttgctacatttgggcgtgt
ccgcctctgaagggcgaggattacattctttattgtcaccctgaaattcagaagactcca
aagtcggacaagttgcgagaatggtacttaacgatgcttaggaaagcgtccagggaaaat
attgttgtcgagattaccaatttctatgacttttttttcatatctcctggcgagtgcaag
gccaaagtgaccgctgcaaggcttccatatttcgatggtgattattggccgggtgccgca
gaagatatgatactgcaactacaacagcaggatgacgatgatggatcaaagcagcagaaa
aagggaaagattaaaaaaccgccaacgaaacgcgccacaaagactgctgctcaggcggaa
atggctatcaacgcttcaaaagatgcgcaactcatgcagaagcttggggagtcgataatg
caaatgaaggaagattttattatggttcatctacagcacacttgcacacactgtagaaac
tttatattgacgggctgccgctgggtttgccggccttgtaagacctttcagctttgtgat
aggtgccatgaagcagagctaaaactggacgaaagggaaagacatcctgtcaatagcaag
gaaatgcattatctaactccgatcgaagttaccgatgttccaccagacaccaaggataat
gatgacttaatggagagtgaattctttgacaccagacacgcgtttttgaccctctgccag
gggaatcactatcagtacgacacactgcggcgggccaagcactcgtctatgatggtgctt
taccacttgcataatcctatggccccggcgttcgtggtgacgtgctgcatttgcacccac
gacatagaaccaggacaaggctggaagtgcgagacctgtacagagtacgacgtttgcaat
ggctgctattacaaggaggagacaaggaagcatcctcacaagctcgtgcaacatccatca
gcatcggagcggaatgctcagaacaaggaagcgaggcaacagcgggtgcaacagcttaag
atgatgcaggagttactcgttcacgcttcgaagtgctgcacaacacagtgccaatatcca
aactgcggagatctcaagaggctgttccggcacggaatgacatgccaaaagcgagttatc
gggaactgcttgcactgcaagaggatgtggagcttcatgcaactacatgcgagatcttgc
aagcaagcggactgccgcgtgcctcgctgcaatcgttgggaagcaagcagtacaaggaac
aacgcttgctttcttgtgtctcttcccagagcaaaggttgaaacaaagcgcaagtaccaa
acatcccaaggagagacaaagatgagagaatga

DBGET integrated database retrieval system