KEGG   Selaginella moellendorffii: SELMODRAFT_429742Help
Entry
SELMODRAFT_429742 CDS       T01496                                 

Definition
(RefSeq) hypothetical protein
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
smo  Selaginella moellendorffii
Pathway
smo00052  Galactose metabolism
smo00500  Starch and sucrose metabolism
smo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smo00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    SELMODRAFT_429742
   00500 Starch and sucrose metabolism
    SELMODRAFT_429742
Enzymes [BR:smo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     SELMODRAFT_429742
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C
Motif
Other DBs
NCBI-GeneID: 9639505
NCBI-ProteinID: XP_002991452
JGI: 429742
UniProt: D8T757
Position
Unknown
AA seq 506 aa AA seqDB search
MLYKGLYHLFFQYNPTAPVFGNISWGHAVSKDLINWSFLDLALQRDKPYDQNGAFSGSIT
FVKGVPVILYTGSALNLDQSQNEAVPANISDPLVRTWKKLEQNPIIFPPPSGVRTVDFRD
PTTAWIGADGLWRILVGAKKNTTGTAILYTSKDFVHWNLADHPLHEVAGTGMWECPDFYP
VSSFGTKGLEDSVRGSGVKHVLKVSLDNTRQDAYTVGTYDAAADKFIPNVPELDTGLGLV
YDHGVFYASKTFYDPEKQRRVLWGWVTEKDSAEADIAKGWAGVQALPRQIWLDETHQNGV
RQWPVAEVYKLRRRDYHSQAHLKLQGGALQEIHSGRKNFQLDIEVTFTVRNHKLVTLDSI
MEDGQTSCLGRTTASREAVGPFGLMVLASDYLQEHTAIYFALLRSKSGWKPLACSDIRRS
SLQPNVTKTAYGGFVNVTGTEQQLTMRVIVDHSLIETFFQGGRACITSRVYPTSGSPRLF
LFNNGSAPIDASIALWGMKNATFTPS
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgctctacaaaggattgtatcacctcttcttccagtacaatcccactgcgccagtattt
ggaaacatcagctggggacacgcagtctccaaggacctcatcaactggagcttcctcgac
ctggctctccaaagagacaagccttacgaccaaaacggtgccttctctggctccatcacc
ttcgtcaagggagtgccggtcattctctacacgggctctgcgctcaacttagatcagtcg
cagaacgaggctgtgcctgcaaacatctcggatccgctggttagaacctggaagaaactg
gagcagaacccgatcatctttccaccaccctccggcgtgcgaacagtagacttcagagat
cccaccacggcctggattggtgccgacgggctttggagaatcctggtgggagcaaagaag
aataccaccggaactgcaatcctgtacaccagtaaagactttgttcactggaacttggcg
gaccatccgctccatgaggttgctggaaccgggatgtgggagtgcccggatttctatccc
gtttcatccttcggaacaaaaggcttggaggattcagtcagaggttctggagtgaaacac
gtactcaaagtcagcttggataataccagacaagatgcttatactgtaggaacttacgat
gctgcggccgataagttcatacccaatgtcccggagctggacactggattaggcctcgtt
tacgatcacggcgtcttctacgcttccaagacgttctacgaccctgagaagcaaagacgc
gtactttggggatgggtcactgagaaagacagcgctgaggctgatattgccaaaggctgg
gccggcgtccaggcactcccgagacaaatctggctggatgaaacacaccaaaatggagtt
agacagtggccagtagccgaagtgtataaactgcgtcgacgggactaccattcacaggct
cacctcaagcttcaaggtggcgcgttgcaggagatacatagcggcagaaagaactttcag
ctggacatcgaggtcaccttcactgtaagaaatcacaagctagtcaccctcgacagcatc
atggaagacggacaaacctcatgccttggtcgcaccaccgcatcaagagaagcagttgga
ccatttggactaatggttctagcctcggattatctccaagaacacactgcgatctacttc
gcgttgctgagatcgaagtcgggctggaagccccttgcttgcagcgacattcgaagatcg
tcgctacagccaaatgtcacaaaaacagcatacggaggattcgtgaacgttaccggcaca
gagcagcagctcacgatgcgagtgattgtagatcactcgctcatcgagacattctttcaa
ggcggacgggcctgcattacctcccgcgtgtaccctaccagcggctcgccccgcctcttc
ctcttcaacaacggcagcgccccgatcgacgcctccatcgcgctatggggcatgaagaac
gccactttcaccccaagctaa

DBGET integrated database retrieval system