KEGG   Selaginella moellendorffii: SELMODRAFT_431029Help
Entry
SELMODRAFT_431029 CDS       T01496                                 

Gene name
HBT1-2
Definition
(RefSeq) hypothetical protein
  KO
K03350  anaphase-promoting complex subunit 3
Organism
smo  Selaginella moellendorffii
Pathway
smo04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:smo00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    SELMODRAFT_431029 (HBT1-2)
Protein phosphatases and associated proteins [BR:smo01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     SELMODRAFT_431029 (HBT1-2)
Ubiquitin system [BR:smo04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     SELMODRAFT_431029 (HBT1-2)
Chromosome [BR:smo03036]
 Eukaryotic Type
  Sister chromatid separation proteins
   APC/C complex
    SELMODRAFT_431029 (HBT1-2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TPR_1 TPR_2 TPR_8 ANAPC3 TPR_12 TPR_16 TPR_19 TPR_11 TPR_14 TPR_17 TPR_7 TPR_9 TPR_15 TPR_10 ChAPs HrpB1_HrpK Coatomer_E TPR_20 Coa1
Motif
Other DBs
NCBI-GeneID: 9646115
NCBI-ProteinID: XP_002992891
JGI: 431029
UniProt: D8TBA6
Position
Unknown
AA seq 655 aa AA seqDB search
MEACLVDSINASLKLYMYRNATFLCERLYAESATEANLHLLATCYFRSNQAYRTYYLLKG
IKSPQCRYLFALACFEMGNMAEAEAALQPSDSPSEVPNGAAGYYLLGLICRFTDRRQAAI
AHYTQALSLDPFFWSAYEDLCLLGVEEDPLSQSQWEVKSQYTYNTPSPSVSQLVTTKSTV
APVHPQRRKFLDEGKLRKVSGRLFTEPPRRSLRLSAESPSTINVCSIPSPVAVSTPTSTA
SVRVSSNSSVRVSNSRKIISGSAEGPLDDGRRVYESLETLGSDEMSNTSSQQSSPVIDDE
LRRSVSVGFVSRGSKLGEGATELLALLKVLGEGFKHVCMYESQEALEAFAKLPQNQYETG
WVLCQIGRAYFEMVDYAEAERAFSWARRVSPYRLEGTDIYSTVLYHMKKDVELSYLAQEV
VSMDRLSPQAWCVIGNCFSLQKDHETALKFFQRALQLDSHFTYAYTLCGHEYVAMEDFEE
GLTCYRNAIRMDGRHYNAWYGLGTIYLRQEKYELAEYHFRRALQINERSSVLHCYLGMAL
HALKRSHEALELLGEAIRADPKNPLPKYQKANVLMSEERYNDALGVLEQLKEVAPRESSV
YFLIGKVYKRLGQPESAMYHFCVALDLKPSTADVNLIKNAIEKLHVPDESEEENL
NT seq 1968 nt NT seq  +upstreamnt  +downstreamnt
atggaggcgtgcctcgtcgacagcatcaatgcgtccttgaagctctacatgtatcgcaat
gccacattcctctgcgagcgcctctacgcggagagcgctaccgaggcaaatcttcacctt
ctcgcgacctgttattttcggagcaatcaagcataccgcacatattacctccttaaaggc
attaaatcgccacagtgtcggtatctatttgcactggcctgctttgaaatgggtaatatg
gctgaagctgaagctgcgctacaacccagtgattctccatccgaggttccaaatggagca
gccggttactatctgctaggacttatctgtcggtttacggaccgcagacaagctgctatt
gcgcattacacgcaggcgctgtctctggatccattcttttggtcagcttacgaagatttg
tgtctgctaggtgttgaggaagatccactatcacaatctcagtgggaagtcaagtctcag
tatacatacaacacgccttctccaagcgtttctcagttagtgactacaaagagtactgtt
gctcccgttcatcctcagagacgaaagttccttgacgaaggaaagcttcgaaaggtgtcc
ggtagattattcactgagcctcccaggcggagtttgaggctttctgccgagtctccatcc
acaatcaatgtttgctcaattccaagtcctgtagccgtgtcaacacctacgtcaactgcg
agcgtccgggtatccagcaatagctccgtccgtgtttctaattcgcgtaagattatttcc
ggaagtgccgaaggtcctcttgatgatggccgaagggtttacgaaagcttagaaactctt
ggaagcgatgaaatgtcaaataccagcagtcagcagtcttctcctgtgatagatgacgaa
cttcggcgcagtgtctccgttggctttgtgtcccggggctcgaagcttggggagggtgct
acagaactcttggctcttctaaaagtccttggtgaaggcttcaagcatgtttgtatgtac
gaaagtcaggaagcactagaagcttttgcgaagctcccacaaaatcagtatgagactggg
tgggttttatgccaaatcggaagagcatactttgagatggtggattacgcagaagccgag
cgtgctttcagttgggctcggagagtgtcaccctacaggcttgaaggaactgacatctac
tcaaccgtgctctatcacatgaagaaggacgtggaactgagctatctggcacaggaagtg
gtatccatggatagattgtctccacaagcatggtgtgtgattggaaactgctttagtttg
cagaaagaccacgaaacggcactaaagtttttccagcgggccttacaactcgattctcac
ttcacatacgcgtacactctatgtggacacgaatatgttgcaatggaggacttcgaagaa
ggccttacttgctatagaaacgcgatacgtatggatggacggcactacaacgcgtggtat
ggacttggtacaatctatctacgccaggaaaaatatgagttggctgagtaccacttccgt
cgtgccttgcaaatcaatgaacgctcttcagtgctccactgctacctgggaatggcgctg
catgctctaaagaggagccacgaggctttggaactgcttggcgaagcgatacgggctgat
cccaagaatcctcttccaaagtaccagaaagcgaacgttctaatgagcgaggagagatac
aacgacgctctcggagttctggagcaactcaaagaagtcgcgcctcgcgagagcagcgtc
tacttcttgatcgggaaagtctacaagcggctgggacagccagagagtgccatgtatcac
ttttgtgtcgcgttggatctcaagccatccactgcagacgtgaatctcatcaagaatgcg
atagagaagcttcatgttccagacgagtcagaagaagagaacttgtaa

DBGET integrated database retrieval system