KEGG   Selaginella moellendorffii: SELMODRAFT_43201Help
Entry
SELMODRAFT_43201  CDS       T01496                                 

Definition
hypothetical protein
Orthology
K01177  
beta-amylase [EC:3.2.1.2]
Organism
smo  Selaginella moellendorffii
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smo00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SELMODRAFT_43201
Enzymes [BR:smo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.2  beta-amylase
     SELMODRAFT_43201
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 431 aa AA seqDB search
LGLISESNELVNPEGIRRDLQALKSVNVDGVMVDCWWGLVEDTPQKYNWCAYRELFTIVK
ESDLKLQVVMSFHQCGGNVGDDVNIPIPKWVLEIGKENPDIFFTDKHGHRNPECLTWGVD
KERVLKSRTGLEVYFDYMRSFRQEFDDLFQSGVIAEIEVGLGACGELRYPSYVPRSGWEY
PGIGEFQARKQKTQCYDKYLIKSLKQAAEARGHTEWGCCPDNAGEYNSKPQETDFFRDGG
DYDSYYGRFFLKWYSKVLIEHGDRVLMLAKLAFEGFHIASKVSGIHWWYKTASHAAELAA
GFYNPCNRDGYVEIAEMFAKHDASLNFTCVELRTLAQEEDFPEALADPEGLVWQVLNAAW
DAGIYVASENALPCYDRDGYNKILENAKPSKNPDGRHISAFTYLRLSPVLMEEHNLQEFA
RFVKRLHGTQV
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
ctgggtctgataagcgagagcaacgaacttgtcaatccagaaggtatacgtagagactta
caagctctgaaatccgtgaatgtcgatggagttatggtggactgttggtggggactcgtc
gaggacactccacaaaaatacaactggtgtgcttacagagaactctttacgattgtcaag
gaatccgacttaaagctccaggttgtgatgtcgttccatcaatgtggaggaaacgtcggt
gacgacgtgaatataccaattccaaagtgggtgctggagattgggaaggagaacccggat
atcttcttcacggacaagcatggacaccggaatcctgagtgtcttacctggggagtggac
aaggaacgcgttctcaagagccggaccggactcgaggtgtactttgactacatgagaagc
tttcgccaagagtttgacgatctcttccagtctggagtgattgctgagatcgaagttgga
ctcggtgcctgtggagagcttcggtatccttcgtatgttccgagaagcggttgggagtat
cctggcattggagaattccaggcaagaaaacaaaaaacacagtgctatgacaagtacctg
ataaagagcttgaagcaagcagccgaggcaagaggccataccgagtggggatgctgcccc
gataatgctggagagtataactccaagccacaggagacggatttctttcgcgatggtggc
gactatgatagttactatggccggttcttcctgaagtggtactccaaggtgctgatagag
catggagaccgcgttcttatgctggcaaagctggctttcgaaggctttcacatagcatcc
aaagtttctggaatccactggtggtacaagaccgctagccatgctgcagagctcgccgcc
ggcttttacaacccgtgcaatcgcgatggctacgttgaaatcgccgagatgtttgcgaag
cacgatgcttctcttaacttcacctgcgtggagcttcgaactttggctcaagaggaagat
tttccggaagctctagcagatcccgagggtctggtatggcaggtgttgaacgctgcttgg
gacgccggtatctatgttgcaagcgagaatgcgttgccgtgctacgaccgagatggttat
aataagattctggagaacgcaaagccttccaaaaatccagatggtcgacacatctcggcc
ttcacgtacttgaggctcagtcccgtgcttatggaggagcacaacttgcaggagtttgcg
aggttcgtcaagaggttacacggtacgcaagtt

DBGET integrated database retrieval system