KEGG   Selaginella moellendorffii: SELMODRAFT_437417Help
Entry
SELMODRAFT_437417 CDS       T01496                                 

Definition
hypothetical protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
smo  Selaginella moellendorffii
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:smo00500]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 798 aa AA seqDB search
MEIAIASAVCPAISPCSSSKERQQQPLRSSRGLLRRSTLVSGQKIMADPRWNFHRSVIKA
VKTEEHVAREDLPVVRVDPLLAPHQDHLKYRFSQYERRKRAIEKYEGGLEKFSLGFQKFG
FNYEDGYIVYREWAPPAQAAQLIGDFNNWDGWSHPMEKDKYGVWSVRIPDVDGKPGIPHG
SRVKFRMQKGDGQWIDRIPAWIKYATVEAGKMGASYDGILWNPSEDQRYKFEHPRPPKPV
VPRIYEAHVGMSSKEPCVASYIDFADNVLPRIKANNYNTVQLMAVMEHSYYASFGYHVTN
FFGVSSRSGTPEELKYLIDKAHSLGLRVLMDVVHSHASNNIKDGLNGFDLGQQTQESYFH
TGDRGYHKLWDSRLFNYNNWEVERFLLSNLRWWLEEYQFDGFRFDGVTSMLYHHHGIHMS
FSGRYRDYFSEASDVDAAVYLMLANELVHTLYPDATTIAEDVSGMPTLGRPVSEGGVGFD
YRLAMGIPDTWIKLLKEVTDEHWSMAEIASTLLNRRYTEKAIAYAESHDQSLVGDKTLAF
MLMDKEMYAGMSALQEQSIIIERGIALHKMIHFLTMALGGDGYLNFMGNEFGHPEWIDFP
REGNKWSYDKCRRQWDLVDTDHLRYKFMNEFDKAMNALEEKYHFLTLPLIVSSAHDKDKV
IVFERGDLVFVFNFHPETTYEGYKIGCDLPGKYKIALDSDAFDFGGRGRVGHDVDHFTSP
EGIPGRPETNFNNRPSSFLVLSPARTCQVYFKVPEDAVQSEEENEEPAASVLQLISQSAA
QKDLPFNFMDDIPDFSQD
NT seq 2397 nt NT seq  +upstreamnt  +downstreamnt
atggagatcgccattgcctccgccgtgtgtccggcgatctcgccctgctccagctccaag
gagcgccagcagcagccgcttcggtcgagccgggggcttctccggcgatcgacgctcgtg
tcaggtcagaaaattatggctgatccgcgatggaatttccaccgttcagtgatcaaggca
gtgaagaccgaggagcatgtagcaagagaggatttgcctgttgtgcgagtcgatcccctg
ctggctccacaccaggaccatcttaagtaccgattttctcagtacgagaggaggaagaga
gccatcgagaagtatgaaggtggtcttgagaagttttctttgggctttcagaagtttgga
tttaattacgaggatggttatatagtctaccgggaatgggctcctcctgcacaagcggct
caacttattggggactttaacaactgggatggatggagccacccgatggagaaggataaa
tatggtgtgtggtcagtacgcataccagatgttgatgggaagcccggaattcctcatgga
tccagagttaaatttcggatgcagaagggagatggccagtggatcgatcgtatacctgcg
tggataaagtatgcgactgtggaagctgggaaaatgggagcttcttacgacggaattctg
tggaatccatcggaagatcagaggtacaagtttgagcatccacgacctcccaagcctgtc
gttcctcgcatatacgaagcacacgttggcatgagttccaaggagccatgtgtagcgtcc
tacatcgactttgcggacaatgtgcttcctcggatcaaggcaaacaactacaacacggtt
caactgatggcagtgatggagcactcttactacgcttcctttggctaccatgtcacaaat
ttcttcggtgtgagcagccgctcgggaactcctgaagagttgaagtatttgatcgacaaa
gctcactctctgggcttacgggtgctgatggacgttgtgcacagccatgcaagcaacaac
attaaagatggtttgaacggattcgacttggggcaacaaacgcaggaatcatattttcac
acaggggatcgaggctatcacaagctctgggacagtcggcttttcaactacaacaactgg
gaggtcgaaaggtttttgctatcgaatttgcggtggtggctggaagaataccagtttgac
gggttccgttttgatggagtcacttctatgctgtaccatcatcacgggatacacatgtca
ttctcaggaagatatcgagattacttcagcgaagccagcgatgtggatgctgctgtctac
cttatgctcgccaacgagctcgtccacactctttatccggatgcaacgacaattgcggaa
gatgtctcgggaatgccaacgcttggtaggcccgtttctgaaggaggcgtgggatttgat
taccgcttggccatgggaattccagatacctggatcaagcttctcaaggaagtgaccgat
gagcattggtcaatggctgagatagcatcaacgcttttgaacaggagatacactgaaaag
gccatcgcctatgcagaaagtcatgaccagtctctggtgggggacaaaaccttggctttt
atgcttatggacaaagaaatgtacgcaggaatgtccgctttgcaagagcaatccatcatt
attgaacgagggatcgcacttcataagatgatccattttcttacaatggctcttggagga
gatggttatttgaattttatgggaaatgagttcggacatccagaatggatcgactttccc
agagagggtaacaagtggagctatgataaatgccgacggcagtgggatttggtcgacacg
gaccatcttcgatacaagtttatgaacgaatttgacaaagctatgaatgcgctggaggag
aaatatcactttctgacgttacctctaattgtttcgagtgcgcacgacaaagacaaggtc
attgtctttgaaagaggagatttagttttcgtgttcaacttccatccagagacaacctat
gaggggtataagattggatgtgatcttcccggaaagtacaaaattgctttagacagtgat
gcatttgactttggtggccgtggccgggttggtcatgacgtggaccatttcaccagtccc
gaaggtatccctgggaggcccgaaacaaacttcaacaatcgtccaagctctttccttgtt
ctgtcaccagctcggacatgccaggtttattttaaagttccggaagacgccgtccaatcc
gaggaagagaacgaggagccagcggcaagcgtcttgcagcttatatcccagtccgccgca
caaaaggatcttccattcaattttatggacgacataccggacttctcacaagactaa

DBGET integrated database retrieval system