KEGG   Selaginella moellendorffii: SELMODRAFT_439240Help
Entry
SELMODRAFT_439240 CDS       T01496                                 

Definition
(RefSeq) hypothetical protein
  KO
K06176  tRNA pseudouridine13 synthase [EC:5.4.99.27]
Organism
smo  Selaginella moellendorffii
Brite
Enzymes [BR:smo01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.27  tRNA pseudouridine13 synthase
     SELMODRAFT_439240
Transfer RNA biogenesis [BR:smo03016]
 Eukaryotic Type
  tRNA modification factors
   Psudouridine synthases
    SELMODRAFT_439240
 Prokaryotic Type
    SELMODRAFT_439240
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TruD
Motif
Other DBs
NCBI-GeneID: 9655356
NCBI-ProteinID: XP_002965772
JGI: 439240
UniProt: D8R301
Position
Unknown
AA seq 660 aa AA seqDB search
MEEKDVGILCFANSFPGFRAVLKQRYSDFIVNEVDLDGNVVRLTSLTAPPEDETRSEAAA
AEFSVASYEAQLDAFKELAGEENARIVKQLLDKISPEQADDGNALVETLTPNEDKGSRTK
VHAFFRERMPMLITDTVADNRIRVRYGGGSASDDRAGKRNRSWKGKRGYESKRQRQDGDK
FDRRAGNYWPADRHKFCQFYLYKENKTTQSALMIVAQKIGVKAKNMGFAGTKDKRAVTTQ
RVTVYKHSATQLAALNKSLFGIKLGNFSYVEKGLVLGELSGNRFNVILRDVVAESENAIK
EAAEGMGNSGFINYYGLQRFGSCGVPTHAIGAKLLQGDWKTAVDLILQEREGDQQAAEES
RKIFKTAGPAEALKLMPHHMIAERAILLGLKKDPANYLQAIQNIPRPMRMMYVHSYQSYL
WNSAASARIQKYGNPLLSFSNGVKDVAFTGVDAVVEGDLVYCQEDEISKEAGKDDVELED
LVDTDVLEDDARMELARPSRKKVKHVTAEDIALKKYAITDVVLPLVGSTTVYPSNDVADV
YNKITKMESIDLKSCTHNVKEFSVEYLTGAYRNLLVKPIDFEWRLSSYSDSRNPLTKTDM
DLLQDPSTSLPEEDANSTQGPSLLALQLQFTLPTSAYATMAIREVMKMSTSVSLHKLLSQ
NT seq 1983 nt NT seq  +upstreamnt  +downstreamnt
atggaggagaaggatgttgggattttgtgcttcgcgaattccttccccggttttagagct
gttctcaagcaaaggtactccgacttcatcgttaacgaggtggatctcgatggcaatgtg
gtgcgattgacgagcttaacagcgccaccagaggatgaaacccggagtgaggccgctgcc
gcggagttttccgtggcttcatacgaagcacagctcgatgctttcaaggaactcgccggc
gaggagaatgctcgtattgtcaagcagctccttgacaagatttctccggaacaggccgat
gatggaaacgcactggtggaaactctcacgccaaacgaggataaaggcagccgcacgaaa
gttcacgcgttctttcgggagagaatgccgatgcttataactgatactgtggcggacaat
cgcattcgcgtgagatacggtggcggctcagcttctgacgatcgagctggcaaaaggaat
cgaagctggaaaggaaagcgaggctatgaatcgaagcgacagagacaagacggtgacaag
tttgatcgtcgcgcaggaaactactggccagctgatagacacaagttttgccagttttac
ctatacaaagagaacaagactacgcagtcggctttgatgattgtagctcagaagattggc
gtaaaggcaaagaacatgggttttgcggggacgaaagataagcgtgcagtaacaacgcag
cgggtcactgtttacaagcattcagcaacacaactcgcagcacttaacaaatccttgttt
ggtatcaagctaggaaactttagctacgttgagaagggcttagttcttggagagctttct
ggaaatcgcttcaacgtgattttgcgtgatgtcgttgcagagtccgagaatgcgatcaag
gaagcagctgagggcatggggaactctggttttatcaactactatggcttgcagcgtttt
ggaagctgtggtgtgccgacgcatgctataggcgccaagctgctccaaggtgactggaaa
accgcagtggatctgatactccaagagagagaaggagatcagcaagcagctgaggaatct
cgtaagatcttcaagactgctggtcctgccgaggccttaaagctcatgccgcaccatatg
attgccgaaagagccattcttcttggcttgaaaaaggatcctgcaaactacttacaggcc
atccaaaacattcccaggccaatgcggatgatgtacgtccacagctaccaaagctatttg
tggaacagcgctgcaagcgcgaggatacaaaaatatggtaatccacttttgtcattctca
aacggtgtcaaagacgtagcttttacaggggtggatgctgttgtggaaggtgatctcgtc
tactgtcaagaggatgagatttctaaagaagccgggaaagatgatgtggaacttgaggat
cttgtagacacggacgtcctagaggatgacgctcgcatggaactcgctcgcccatctcgg
aagaaagtaaagcatgtcacagcggaagatattgccttgaaaaagtatgcgataaccgac
gtggtcttgcctttagtcggttccaccactgtttatccatcaaacgatgtggccgatgtc
tacaataaaatcacgaaaatggaatcaatagatttgaagtcttgtacacacaacgtgaaa
gagttctcggtggagtatttgacaggagcatatcgaaacttactcgtgaagcctatcgac
ttcgagtggagattatcctcgtacagcgactcccggaatcctctgacaaaaacggacatg
gatttgctccaagatcctagcactagccttccagaagaagatgcaaactccactcaaggc
cccagccttctggcattgcagctgcaattcactctcccaacgtcggcctatgccacaatg
gcgataagagaggtcatgaaaatgtctacctcggtctccttgcataagctgctatcacag
tag

DBGET integrated database retrieval system