KEGG   Selaginella moellendorffii: SELMODRAFT_439663Help
Entry
SELMODRAFT_439663 CDS       T01496                                 

Definition
hypothetical protein
Orthology
K14310  
nuclear pore complex protein Nup205
Organism
smo  Selaginella moellendorffii
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:smo00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    SELMODRAFT_439663
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 1862 aa AA seqDB search
MVSYRRLQSTVEVVLAGSPSPQQRTELFHMLHLCRPEFESFLLYPEPKAADRTEVLSKEV
KLPDAPPTVLDDQDVQIALKLSDDYHLNEIDCVSLLVAAHQEVKNDLKFVQWNLLGREPL
EGLRLSAGLWFTERRALINSLQLILRAVVLDEELDPDLVVDLRQYIESLIDAGLRKRLVT
LIKELGREDPSGLGGPGVEPYVMDARGALVLRHDVALRERLSICQCLVFSCLIVRINSQE
AKDIYGLVKDCSGDPFSSQSVVKLQIAYTVMFTLAISLISDALGGGHEMGSVLSPDAVFR
REFHNQVMEVGLESTTKGFTDVIRLVWGVFLMSNVDTSGISINESQSDITNARACLDHAC
EQNVFKFLVEKILKAAAFENDDPDLVFMYNAYLHKLFIIFLSNPIGREKIKDLKNVAMFS
DPYPTEEPMEDDLITRRQAMQTQADPFISLLELISEVYQREPALVSDNEVLWNFIRFISE
DHSSYLTLVAFLKMLVGLACSEEGARQVYQMLQNKTFRTVSWQTLFNSLNVYEEHFRHCI
QTSGSLLPPFQEGDAKALDAYLQVLKKVLEAGSEVERALWFPDIEPLFKLLPFENVPPYL
KGSLRNAISAFVPLSPVIRDRVWSLLDAYDLPLSAATTLGGANVQQVYDMTFELNEVEAR
QEEYPSTISYLNLLNVLMANDPDKSHKGQKFAGIFKFVRDQVFGPYAQRAYADPTYKWQM
VVASLRHFQMMLTLYDVSEGDLQNSLEGSEQSFGGAKLYLPPIEIMKDLMGGKSIFRSLM
SIVMLGADFVLEERISKNYGPSLEEAVQLCLELLVIAFQKDIFYADHWRPIYQTIDAILS
HDSRQIITLIQYIHYESLSTIQHLSIKIMDVFRCDCFTPSNCAKRVLLDSSRLPHIVSLI
VDANAATNLVEDYAACLEARSHELQTSDCVKEDSGSLILRLLLSNLNRPSPNLAHLLLTF
DIDQPVERTILQPKRLVYELCVDEFTSGPMLDLMRTEKYDFFSCHLDSACEPLPKRETNH
SLRISSLQQRAWLFKLLALDLHVSDMDVLSHRRSCRRLVGKLFMDESVDPLPVTNAVPAL
LTNYGLQKMKVLELLDILQFSLAEPPTEIPQCIEDFKEDLKVEEILNNPALVDDGGIYTL
SERGDRIIDLTAFRDKLWQACKRLEMQYNILANERRQVAVRDAVQQLLRWAWKRNKFLEE
QAAQLHMLVGWTQLVEVTFSRRFEFLGNRIQVIYDTLEAVLDASCSSDCSLSMAYVLSQV
VLTSMAKLQDHGIFAPGEEDYNDDATYGDVLTTVRLPNTACQTILSKLLTGVLRPESSEA
LRRRQFASLLSYFHYCQGMVNSELSVSMMRGLLMEGQDGVEDTEFEKLEGDQAELAQMNF
NMLRQEATALLDLVVKDALHGSETGKAIAFYVLEALVAVDRNQLFFGHLQSRGLLNSCFT
DISTNSYQALILPSRDMIRRLYTLEAELALLLRVCFHNKKRGAQALFAMGAIQHLSSCKA
IDVQLTDDARKEHMGIGLPSQHDRQHQIVIPVLRLILCFTTLIDTGRKDRDEVALEVLEF
VKLHHGLFDRILRDDGTKMYLADLEELHLATAILSKVWPFEGSEDFGFKQGLFNLAYIYF
AQDNQSRSGFIQFSKSQRQNMGVPAEDSKKIELLVTRLRGNLVSYIHTLVSKQGMRLNIS
GTDSSEVVMRHYTLGLQRQPSLKLVSSLLEQAALDLESSAEEKMLIVAKLPDINELTRQE
VDDIAKSKQGSEMESMRKRRYLAMVEMCTDASIRDTQIACLVLVVEQALEILYLHVEAIQ
EAAQGAQDSTQAHKGELDALGQKLLPTFEKLESIKEDKVGRGVKHIHRLIYSLKSQTRRY
FD
NT seq 5589 nt NT seq  +upstreamnt  +downstreamnt
atggtttcttacaggcgcctccaatccacagtggaggtggtgctggcgggatcgccatcg
ccacagcagcgcacggagctcttccatatgctgcatttgtgccgcccagagttcgaatcg
ttcctcctctatccggagcccaaggcagccgatcgaacagaggttttatcgaaagaagtg
aagctgccggacgcgccgcccaccgtgctcgacgatcaggatgttcaaattgctttgaaa
ctcagtgacgactatcatttgaatgagatcgattgcgtgagtcttctcgtcgctgctcat
caagaggtgaaaaacgaccttaagtttgtgcagtggaatctcttaggacgtgagcctctc
gagggcctccgactatcagcagggttgtggttcacggaaagaagagcgctaatcaactcc
ttgcagcttattctgagagccgttgtgcttgacgaagagcttgatccagacttggtcgtt
gatcttcgacaatacatcgagagtttgattgacgctggactacgcaagcgacttgtgaca
cttatcaaggaacttggtcgcgaagatccgtctggcttaggcgggccaggggttgagcct
tatgttatggatgccaggggagctcttgtactacgtcatgacgtcgcacttagagaacgg
cttagcatatgccagtgtttggtcttttcatgccttattgttcggatcaattcgcaagaa
gcaaaagacatctatggtcttgttaaggactgttcgggagatccattttcgtcacaatcc
gtcgtcaagcttcagatagcgtacacagtgatgtttacccttgcaatctcgttaatatcg
gatgctctcggtggtggtcacgagatgggatctgtgctttcgccagatgctgtatttcgc
cgtgagttccataatcaggttatggaggtggggcttgagagcacaacgaaaggttttaca
gatgtcattagactagtatggggggtcttccttatgtctaacgttgacacgagcggtatt
tcaatcaacgaatcacaatctgatataacaaatgctcgagcatgtcttgatcacgcttgc
gagcagaacgtttttaaattcctcgttgagaaaattttaaaagctgccgccttcgagaat
gatgatccagatcttgtgttcatgtacaatgcttatttgcacaaacttttcataatattt
ttgtccaatccaatcggcagagagaagatcaaagatttgaagaatgtcgccatgttttct
gatccatatccgaccgaggagccaatggaggatgatttgataacacgccgtcaagctatg
caaacacaagctgatccttttatatctttgctcgagcttatatcagaagtctaccagaga
gaaccagcacttgtttctgataatgaagttctttggaacttcataagattcataagcgaa
gaccattcaagctaccttacattagttgcttttctcaagatgctggttggattggcttgc
agtgaggaaggggctagacaagtgtaccagatgctacagaacaagactttccgtactgtt
agttggcagacgctttttaattcgctcaatgtctatgaggagcacttcagacattgcatt
caaacaagcggttctttgctccctccttttcaggagggagatgccaaagctcttgacgcc
tatttgcaagttttgaaaaaggtcttggaggctggtagcgaggtggaaagggcactctgg
ttcccggatattgaaccgctttttaagcttctcccatttgaaaatgttccaccgtatttg
aagggatctttgcgaaatgcaatctctgcctttgttccgttatctccagttataagagac
agagtatggagcttactggatgcttatgatcttcctctgtcagctgccactacattggga
ggagccaatgtgcaacaagtttacgacatgacgtttgaactgaatgaagtggaggcaagg
caagaagaatatccctctacaatttcatatttgaacctgctgaatgttctgatggcaaat
gaccccgacaagtctcacaagggtcaaaaattcgctggcatattcaagtttgtccgagat
caggtgttcggtccgtatgctcaaagggcctatgctgatcccacatataaatggcagatg
gtggttgcatcccttaggcacttccaaatgatgctgacgctatatgatgtgtccgagggg
gatcttcaaaattccttggaaggatctgagcagagctttggcggagcaaagctgtatctt
ccaccaattgaaataatgaaggatttgatgggcggaaaatctatcttccgaagtctcatg
agcattgttatgcttggagctgattttgtactggaggaacgcattagcaaaaactatggt
ccatctcttgaggaagcggtgcagctttgtttggagcttttagttattgcctttcagaaa
gatattttttatgccgaccactggcgaccgatttatcagactatcgatgctatattgtcg
catgacagccgccaaatcataaccttgatccagtacatccattatgaatcgctatcaact
atccaacatctgtcgatcaagatcatggatgtctttaggtgcgattgttttacaccatcg
aattgcgctaaaagagttttattggacagttctcgattgccacacatagtttctttaatt
gtcgatgccaatgccgcaacaaatcttgttgaggactatgcagcctgtttagaagcccgc
agtcatgaacttcagacttctgactgtgttaaagaagattcgggctctcttattttgcgg
ctgcttttgtcaaacttgaatcgaccttctccaaatctagctcatttgttactcacgttt
gacatagatcaacctgttgaacggacaatccttcaaccaaaacgcctggtgtatgagctc
tgtgtcgatgaatttacaagtggcccgatgcttgaccttatgcgaacggagaaatacgat
ttcttttcttgccatttggactctgcttgtgagccacttcctaagcgagagacaaaccat
tctttacgtattagcagtttgcagcagagagcatggctttttaagctattggcactggat
ttgcatgtcagtgacatggatgttttgtcacatcgtcggagttgtcgtcgccttgtgggg
aagctttttatggacgaaagcgtggatcctctgcctgtgacaaatgccgtgccggcgttg
cttactaactatggccttcaaaaaatgaaggttctggagctccttgatatcttgcagttt
tctttggcagagcctccaaccgaaattccacagtgcatagaagactttaaagaagatttg
aaggttgaagagattctgaacaatccagcattggtcgacgatggtggcatctatacgctt
tcagaacgtggcgacagaataatcgatctgactgctttcagggacaagctttggcaggcg
tgcaagaggctagaaatgcaatataacattttggcaaatgagcgacgccaagtggcagta
cgtgacgccgtgcagcagctacttaggtgggcatggaagcgcaacaagtttttggaagaa
caagctgcacagttacacatgcttgtgggatggacccaactagtagaggtgacattctcc
agacgatttgagttcttagggaaccgcattcaagtgatctatgacacactggaagcggtt
ttggacgcaagttgttcttcagactgttctttgagcatggcttatgtcttgagccaggtt
gtgctgacatcaatggcaaaacttcaagatcatggtatatttgcgcctggtgaagaagat
tacaatgatgacgctacatatggagatgttttgacaacggtccgtttacccaataccgcg
tgccagaccatcctctcgaaactccttaccggtgtattgcgacctgagtcatctgaagct
ttaagacgaaggcaatttgcatctttgttaagctattttcattattgccaaggcatggta
aattcggaactttcggtttccatgatgcggggacttttgatggaggggcaagacggcgtt
gaggacacagaattcgaaaagctagaaggggatcaggccgaacttgctcaaatgaacttt
aatatgcttaggcaggaggctactgccctgcttgacttggttgtaaaagatgcattacat
ggaagtgaaacgggaaaggcaattgcgttttatgttctagaggcacttgtggcggttgat
cgtaatcagctgttctttggacatttgcaaagcaggggtttattgaacagctgcttcact
gatattagtacaaattcttatcaggctttaattctaccttctcgtgacatgatccgacgt
ctatatactcttgaggctgaattggcattacttttaagagtgtgttttcacaacaagaaa
cgaggcgcgcaagcattgtttgccatgggtgccatccaacatctgtcatcctgtaaagct
attgatgtccagctgacggacgatgcgaggaaggagcatatgggaattggactgccatca
caacatgacaggcagcatcagattgtcatacccgttctgaggttgattttatgttttacg
acgctaattgacacaggaagaaaagaccgcgatgaagtagctcttgaagttctagagttt
gttaaacttcatcatggtttgttcgaccgtatcttgcgagacgatgggacgaaaatgtat
ctggcagacctcgaagaactccatttggcgactgcaattttatcgaaggtgtggccattc
gagggctctgaggactttggcttcaaacaaggcctgttcaatttggcatacatatatttc
gcgcaggataatcaatcacgtagtggattcattcagttttctaaaagccaacgtcaaaat
atgggggtacctgctgaggactcaaagaaaatagagcttcttgtgacgcgccttcgtggc
aatctggtttcctacattcacacattagtcagcaagcagggaatgagactaaacatctct
ggaacagacagttctgaggtggttatgcgacactacaccttgggacttcaaaggcaaccc
agcctcaagcttgtctcaagtcttttggaacaggcggctttagatctcgaatcttctgcg
gaagagaaaatgcttatcgtggctaagcttcctgatattaacgagcttacaaggcaggaa
gtcgatgacatcgcaaagtctaagcaagggtccgaaatggaaagcatgcgaaagagaagg
tacttggcaatggtggagatgtgtacagatgccagcatccgcgatactcaaatcgcttgc
cttgttctcgtcgtggagcaagctttggaaatcctctacctccatgtcgaagcgatacaa
gaagctgctcaaggagcccaggattcaacgcaggcacacaaaggggagctagatgctctt
gggcagaagctactcccaacgtttgagaagctggagtccatcaaagaggacaaggtagga
cgaggagtgaagcacatccacaggctcatttactctctaaagtcccaaactcggcggtac
ttcgattga

DBGET integrated database retrieval system