KEGG   Selaginella moellendorffii: SELMODRAFT_440021Help
Entry
SELMODRAFT_440021 CDS       T01496                                 

Definition
hypothetical protein
Orthology
K10739  
replication factor A2
Organism
smo  Selaginella moellendorffii
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Class
Genetic Information Processing; Replication and repair; DNA replication [PATH:smo03030]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:smo03420]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:smo03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:smo03440]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 279 aa AA seqDB search
MYGDNAAMDFGGGGFMPSQPSGFATGGGDPSVKKSGAPSSGLFPLTVKQMSRAIQSATDD
NLIVDGQSMSNVTMVGMLLGKEERATDISFMLDDGTGRVEVKRWIESPDAPEALQLHSIQ
HGQYVRIHGHLRTFQNKRTVVAFAVKPITDFNEITFHFLDCIFAHTYNTKSQGAARPDGP
ASPPTFNHTNYSNPVSNPYATPAAPANSNGMSECQRRVQAVFEEPSVKESEQGLHVDEIA
RRITGFSKKQVRDAVEFLVNEGYVYSTVDDEHFKSTNTY
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgtatggggacaatgcggctatggattttgggggcggggggttcatgccctcgcagccc
agcggcttcgctactggaggcggcgatccatccgtgaagaaatctggggctccgagcagc
ggtctcttcccgcttactgtgaagcagatgagccgggcgattcaatcggctactgatgat
aatcttattgtggacggccagtctatgagcaatgtcacgatggtggggatgttgcttggg
aaagaggaaagggcgacggatatttccttcatgcttgacgatggaactggcagagtcgaa
gtgaaaagatggatcgagtcaccggatgctcccgaggctttgcagctacacagcattcag
cacggacagtatgtacgaattcacggacaccttcggacgttccagaacaagagaacagtt
gtcgcttttgcagtgaagcctatcacagacttcaacgagatcacgttccacttcctggac
tgcatctttgcacatacctacaacacgaaatcacagggggcggcaaggcctgacggtccc
gcgtctcctcccactttcaatcacacaaactattccaatccggtatccaatccgtatgct
actccagcggctcctgcgaattccaatgggatgagtgaatgccaacgccgggtacaggcg
gtttttgaggagccatctgttaaggaaagtgagcagggccttcacgttgatgagattgcg
agacgtattactggtttctccaagaagcaagtcagggatgcggtggagtttctggtgaac
gaaggctacgtttactccactgtcgacgacgagcatttcaagtccaccaacacttactaa

DBGET integrated database retrieval system