KEGG   Selaginella moellendorffii: SELMODRAFT_440021Help
Entry
SELMODRAFT_440021 CDS       T01496                                 

Definition
(RefSeq) hypothetical protein
  KO
K10739  replication factor A2
Organism
smo  Selaginella moellendorffii
Pathway
smo03030  DNA replication
smo03420  Nucleotide excision repair
smo03430  Mismatch repair
smo03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:smo00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    SELMODRAFT_440021
   03420 Nucleotide excision repair
    SELMODRAFT_440021
   03430 Mismatch repair
    SELMODRAFT_440021
   03440 Homologous recombination
    SELMODRAFT_440021
DNA replication proteins [BR:smo03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   RPA (replication protein A)
    SELMODRAFT_440021
DNA repair and recombination proteins [BR:smo03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    RPA (replication factor A)
     SELMODRAFT_440021
   MMR (mismatch exicision repair)
     SELMODRAFT_440021
  DSBR (double strand breaks repair)
   HR (homologous recombination)
     SELMODRAFT_440021
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RPA_C tRNA_anti-codon RMI2
Motif
Other DBs
NCBI-GeneID: 9632617
NCBI-ProteinID: XP_002967805
JGI: 440021
UniProt: D8R9G7
Position
Unknown
AA seq 279 aa AA seqDB search
MYGDNAAMDFGGGGFMPSQPSGFATGGGDPSVKKSGAPSSGLFPLTVKQMSRAIQSATDD
NLIVDGQSMSNVTMVGMLLGKEERATDISFMLDDGTGRVEVKRWIESPDAPEALQLHSIQ
HGQYVRIHGHLRTFQNKRTVVAFAVKPITDFNEITFHFLDCIFAHTYNTKSQGAARPDGP
ASPPTFNHTNYSNPVSNPYATPAAPANSNGMSECQRRVQAVFEEPSVKESEQGLHVDEIA
RRITGFSKKQVRDAVEFLVNEGYVYSTVDDEHFKSTNTY
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgtatggggacaatgcggctatggattttgggggcggggggttcatgccctcgcagccc
agcggcttcgctactggaggcggcgatccatccgtgaagaaatctggggctccgagcagc
ggtctcttcccgcttactgtgaagcagatgagccgggcgattcaatcggctactgatgat
aatcttattgtggacggccagtctatgagcaatgtcacgatggtggggatgttgcttggg
aaagaggaaagggcgacggatatttccttcatgcttgacgatggaactggcagagtcgaa
gtgaaaagatggatcgagtcaccggatgctcccgaggctttgcagctacacagcattcag
cacggacagtatgtacgaattcacggacaccttcggacgttccagaacaagagaacagtt
gtcgcttttgcagtgaagcctatcacagacttcaacgagatcacgttccacttcctggac
tgcatctttgcacatacctacaacacgaaatcacagggggcggcaaggcctgacggtccc
gcgtctcctcccactttcaatcacacaaactattccaatccggtatccaatccgtatgct
actccagcggctcctgcgaattccaatgggatgagtgaatgccaacgccgggtacaggcg
gtttttgaggagccatctgttaaggaaagtgagcagggccttcacgttgatgagattgcg
agacgtattactggtttctccaagaagcaagtcagggatgcggtggagtttctggtgaac
gaaggctacgtttactccactgtcgacgacgagcatttcaagtccaccaacacttactaa

DBGET integrated database retrieval system