KEGG   Selaginella moellendorffii: SELMODRAFT_444302Help
Entry
SELMODRAFT_444302 CDS       T01496                                 

Definition
hypothetical protein
Orthology
K11838  
ubiquitin carboxyl-terminal hydrolase 7 [EC:3.4.19.12]
Organism
smo  Selaginella moellendorffii
Brite
Enzymes [BR:smo01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     SELMODRAFT_444302
Peptidases [BR:smo01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   SELMODRAFT_444302
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 1105 aa AA seqDB search
MAAPLEEDESMLVSGKVNDSIEAMEGQTETVSSADNQVVEDPLSGKFSWQIPNFSRITMR
KHYSDTFIIGGYKWRILVFPKGNNVDHLSIYLDVADSATLPYGWTRFAQFSLAVINQFEQ
KLSMRKDTQHQFNSRESDWGFTSFMSLHELYDSSRGYLVNDTVCIEADVNVRKVMDYWAY
DSKKETGFVGLKNQGATCYMNSLLQTLYHIPYFRKAVYHMPTTENDVPSNSIPLALQSLF
YKLQYSDTSVATKDLTKSFGWDTYDSFMQHDVQELNRVLCEKLEDKMKGTAVEGTIQQLF
EGHHMNYIECINVDYKSTRKESFYDLQLDVKGCKDVYASFDKYVEVEKLEGDNKYHAEQN
GLQDAKKGVLFIDFPPVLQLQLKRFEYDFTRDTMVKINDRYEFPLELDLDREDGKYLSPD
ADRSVRNLYTLHSVLVHSGGVHGGHYYAFIRPTLSDQWYKFDDERVTKEEVKRAFEEQYG
GEEELPQTNPGFNNPPFKFTKYSNAYMLVYIRESDKDKVICNVDVKDIAEHLQVRLKKEH
EEKERKRKEKAEAHLYTVIKVAREEDLKTQIGKDIFFDLVDHEKVRSFRIQKQMPFTQFK
EEVAKEFKVPVHCQRFWLWAKRQNHTYRPNRPLTEQEEAQSVGLLKEASNKAHNAELKLF
LEERPEVPSLLVLEKAKDEILLFLKFYDPEQTELRYVGKLFVKQGGKPADILEKLNELAG
FAANTEVQIFEEIKFEPNVMCEPVDKKLTFKASQLEDGDILCYQKALSPQDEGRFRYPDV
PSFLEYVRNRQVVHFRRLDRPKEDEFCLELSKQHTYDDVVERVATKLELDDASKIRLTAH
NCYSQQPKPQPIKYRGVEHLSDMLVHYNQSSDILYFETLDLPLPELQGLKTLKIAFHNAR
TEEVSVHNVRLPKNSTVGDVINELKGLVELSNPDAELRILEVFYHKIYKIFPANEKIENI
NDQYWTLRAEEIPEEEKNLGPQDRLIHVYHYTRDAVQNNMVQNFGEPFFLAVRENETLAE
VRDRIQAKLQVPDDEFSKWKFAFLSLGRPDYLHNSDIVASRFQKRDVYGAWEHYLGLEHS
DTAPKRSHLASQNRHAFEKPVKIYN
NT seq 3318 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgcccctagaggaagatgagagcatgctggtgtccggcaaggtgaacgacagc
atcgaggcaatggaagggcaaaccgagacggtgagcagtgcagacaaccaggttgtagag
gacccgctgtctggaaagttttcgtggcaaatcccaaacttttcgagaattactatgagg
aagcactactctgacaccttcatcatcggggggtataagtggcgtatccttgtcttcccc
aaaggaaacaatgtcgaccatctgtccatctacctcgacgttgcggattctgcgactttg
ccttatggctggactagattcgcgcaattcagcctggcggtcattaaccagttcgagcag
aagcttagtatgcgcaaagatactcagcaccagttcaactctcgtgagagcgactggggt
tttacctcctttatgtcactgcacgaactttacgactcgtctagaggataccttgtaaat
gatacggtttgtatagaggcggatgtaaatgttcggaaggtgatggattactgggcttac
gattcgaagaaggagactggttttgttgggttgaagaatcagggtgcgacctgctacatg
aactcactgcttcagacgctttaccacattccttacttccgtaaggcagtgtaccatatg
cccacgaccgagaacgatgttccctcaaatagcattccactggctttacagagcctcttt
tacaagctgcaatacagtgacacgagtgtggctacgaaggatttaacaaagtcctttggg
tgggatacgtacgactcctttatgcaacacgatgtccaggagttgaaccgtgtgctctgc
gagaagttggaggataagatgaaaggaaccgctgttgaaggaacgattcaacagcttttt
gagggtcatcatatgaactacatcgaatgcatcaacgtcgattacaaatctacgcggaaa
gagtcattttatgatttgcaattggatgtcaagggctgcaaggacgtgtatgcgtcattt
gacaagtatgtggaggttgagaaacttgagggggataataagtaccatgccgaacagaat
ggtttgcaggatgctaagaaaggagtgctctttatagattttccacctgttctccagtta
caactgaagagatttgaatatgatttcactcgcgacacgatggtcaagattaatgatagg
tacgagtttcctttggagttggacttggacagagaagacgggaagtatttgtcccctgac
gcagatagaagtgtgcggaatctatatactttacacagtgtcctggttcacagcggaggg
gttcacggaggacactattatgcttttatccggcctacactttccgatcaatggtacaag
ttcgacgatgaacgggtgacaaaggaggaagttaaaagggcttttgaggagcagtatggt
ggagaagaggaattgccacagaccaatcccggatttaacaaccctcctttcaaatttacg
aagtactccaatgcatacatgcttgtatatatcagagagagcgataaggacaaggttatc
tgcaatgtagacgtgaaagatattgctgagcacttgcaggtgcgcttgaagaaagagcac
gaagagaaagaacggaaacggaaggagaaagccgaggctcatctgtatacagtaatcaag
gttgctcgtgaggaggatttgaaaacacagattggcaaggacatctttttcgaccttgtt
gatcatgagaaagtgcgtagcttccgcatacagaagcagatgccgtttactcagttcaag
gaagaggttgccaaggagtttaaagttcccgttcactgtcaacgattctggctgtgggct
aagcggcaaaaccacacctaccgtccaaatcgaccattaactgagcaggaagaggcacaa
agtgtgggtcttttgaaggaagcttcgaataaggcccataatgccgagctgaaactgttt
cttgaggagcggccggaggtgcctagccttttagttctcgaaaaggcgaaggatgaaatc
ttgctgtttttgaagttctatgacccggaacaaaccgaactacgctacgtgggcaaactt
ttcgtgaaacaagggggaaaacctgctgatattttggaaaagttaaacgagctggctgga
ttcgcggcaaacactgaggttcaaatatttgaagaaataaagtttgaaccaaatgtgatg
tgcgaacccgtggacaaaaaacttactttcaaggcgagtcagctcgaggatggagatatc
ctatgttatcagaaggccctttcacctcaggatgaagggcgattccgttatccggatgtt
ccttcttttctagaatatgtgcgaaacagacaggtggttcacttcagacgacttgacaga
cctaaagaggatgagttttgcctggaactgtcaaagcaacatacttacgacgacgttgtt
gagagagtggctacgaaactagagctggatgatgcctccaaaattcgattaacagcacat
aactgctattctcaacagccgaagccacaaccgattaaataccggggtgtagaacatcta
agcgacatgctcgtgcattacaaccagagctcggatattctttattttgaaaccttggac
ctaccacttccagaactgcaaggtttgaagacactaaaaatcgcttttcataatgctaga
actgaagaggtgtctgtacacaacgtacggcttcctaagaatagtacggttggcgatgtt
atcaatgaattgaagggtctagttgagctgtcgaatccggatgcggagctcagaattttg
gaagtcttctatcacaagatttacaagatttttcctgcaaatgagaagatcgaaaatatc
aacgaccaatactggactcttagagctgaagagattccggaggaagagaaaaatttgggt
cctcaagaccgattgatccatgtctaccactacacacgggacgccgtccaaaacaacatg
gttcaaaactttggagagccattctttctagccgtgcgcgagaacgagactctggcagag
gtcagagaccgtatccaagccaaactacaagtacctgatgatgaattctccaagtggaag
tttgctttcctttcgttggggcggccggattacctacacaatagtgacattgttgctagt
cgctttcagaagcgggatgtctatggtgcttgggagcactacctgggtttggagcactcg
gacacagcaccaaagcgttctcatcttgctagtcagaaccggcacgcatttgagaagcca
gtgaagatctacaattga

DBGET integrated database retrieval system