KEGG   Selaginella moellendorffii: SELMODRAFT_444624Help
Entry
SELMODRAFT_444624 CDS       T01496                                 

Definition
hypothetical protein
Orthology
K01859  
chalcone isomerase [EC:5.5.1.6]
Organism
smo  Selaginella moellendorffii
Pathway
Flavonoid biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:smo00001]
 Metabolism
  Biosynthesis of other secondary metabolites
   00941 Flavonoid biosynthesis
    SELMODRAFT_444624
Enzymes [BR:smo01000]
 5. Isomerases
  5.5  Intramolecular lyases
   5.5.1  Intramolecular lyases (only sub-subclass identified to date)
    5.5.1.6  chalcone isomerase
     SELMODRAFT_444624
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 216 aa AA seqDB search
MAPELLKQGLVIEGTQFPPGLTSPVSQKSLFLAGAGVRSIQINPQVTITVTVLGFYFEDG
ILKHLSGKWSGKSGSELEKEDDFFTDIINAPSEKIFSVTMLKPLPGTEFSKKVMENTKQV
LAESNSLGEDEEKAIEEFSKLFEDQALKPGMGPFYVSSSSGLGVGFTDPDEPSNLKISSS
IGNVKFANALLSTMIGKNPVSPASKACIAQRLSALL
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atggctccggagctcctcaaacaaggtcttgtaattgaagggactcagtttcctccaggt
ttgacatctccggtttcacagaaaagcctcttcctcgctggagctggtgtccggagcata
cagataaatccccaagtgaccatcactgtcacagttttgggattttacttcgaggacggc
atcttgaaacatctgtccgggaaatggtcggggaaatctggctcggagctggagaaggag
gacgatttcttcacggatatcatcaatgctccatccgagaaaatctttagcgtgacgatg
ctcaagcctcttcctggcaccgagttctcaaagaaagtcatggagaacacaaagcaagtg
ctggccgagtcgaattctcttggcgaggacgaggagaaagcaattgaagagttctccaaa
cttttcgaggaccaggccctcaagccaggaatggggccgttttacgtgtcttcctcctcc
ggccttggagtcggctttacggacccagacgagccatccaacttaaaaatctcgtcttca
ataggaaacgtgaagtttgcaaacgctctcctgagcaccatgatcgggaagaacccggtg
tctccagcttcgaaagcttgtatcgcgcaacgcctctcagcgctgctgtaa

DBGET integrated database retrieval system