KEGG   Selaginella moellendorffii: SELMODRAFT_444624Help
Entry
SELMODRAFT_444624 CDS       T01496                                 

Definition
hypothetical protein
Orthology
K01859  
chalcone isomerase [EC:5.5.1.6]
Organism
smo  Selaginella moellendorffii
Pathway
Flavonoid biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Biosynthesis of other secondary metabolites; Flavonoid biosynthesis [PATH:smo00941]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 216 aa AA seqDB search
MAPELLKQGLVIEGTQFPPGLTSPVSQKSLFLAGAGVRSIQINPQVTITVTVLGFYFEDG
ILKHLSGKWSGKSGSELEKEDDFFTDIINAPSEKIFSVTMLKPLPGTEFSKKVMENTKQV
LAESNSLGEDEEKAIEEFSKLFEDQALKPGMGPFYVSSSSGLGVGFTDPDEPSNLKISSS
IGNVKFANALLSTMIGKNPVSPASKACIAQRLSALL
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atggctccggagctcctcaaacaaggtcttgtaattgaagggactcagtttcctccaggt
ttgacatctccggtttcacagaaaagcctcttcctcgctggagctggtgtccggagcata
cagataaatccccaagtgaccatcactgtcacagttttgggattttacttcgaggacggc
atcttgaaacatctgtccgggaaatggtcggggaaatctggctcggagctggagaaggag
gacgatttcttcacggatatcatcaatgctccatccgagaaaatctttagcgtgacgatg
ctcaagcctcttcctggcaccgagttctcaaagaaagtcatggagaacacaaagcaagtg
ctggccgagtcgaattctcttggcgaggacgaggagaaagcaattgaagagttctccaaa
cttttcgaggaccaggccctcaagccaggaatggggccgttttacgtgtcttcctcctcc
ggccttggagtcggctttacggacccagacgagccatccaacttaaaaatctcgtcttca
ataggaaacgtgaagtttgcaaacgctctcctgagcaccatgatcgggaagaacccggtg
tctccagcttcgaaagcttgtatcgcgcaacgcctctcagcgctgctgtaa

DBGET integrated database retrieval system