KEGG   Selaginella moellendorffii: SELMODRAFT_445016Help
Entry
SELMODRAFT_445016 CDS       T01496                                 

Definition
hypothetical protein
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
smo  Selaginella moellendorffii
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Glycosaminoglycan degradation
Glycosphingolipid biosynthesis - globo series
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:smo00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    SELMODRAFT_445016
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    SELMODRAFT_445016
   00603 Glycosphingolipid biosynthesis - globo series
    SELMODRAFT_445016
   00604 Glycosphingolipid biosynthesis - ganglio series
    SELMODRAFT_445016
   00511 Other glycan degradation
    SELMODRAFT_445016
Enzymes [BR:smo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     SELMODRAFT_445016
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 537 aa AA seqDB search
MLVAISILVFLPVALGGASSGIHGFAEEKEIPVWPKPHSLLASGSGSLALAENFTLRSSP
DSIATLSSAFARYREIIFLHHSIFLASRQIPESIPQLQALSVRISSPDETLQIGVDESYR
LQIPDPDDATAALLTAETVYGALHGLETFSQICAFNFTTKMTEVRYIPVDIVDRPRFEYR
GLLIDTSRHYEPLKIVRSVIDSMAYAKLNVLHWHIVDTQSFPLEIPSFPKLWNGAYTGAE
RYTLEDAKGIVEYARLRGINVMPELDVPGHAASWGVGYPELWPSGNCTQPLDVSNFAKTF
PFKFMHLGGDEVDTTCWKKTRHIARWLAHNNFTAKQGYEYFVLRAQKIALKYGLTPVNWE
ETFNNFGSKLNNETIIHNWSKLYPYVFLGYSHSWNLLFRIGPGLAPLVVGAGFKCIVSDQ
DVWYLDHLDVPWQSFYKNEPLTNITGEHEQSLIIGGEVCMWGETVDPSDIHQTIWPRAAA
AAERLWSPRSFTDQGTSQVHSRLKTFRCLLQQRGIPAAPVDELGRVSPPYPGSCYDQ
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
atgctcgtcgcaatctccatcctcgttttcctcccagtcgctctgggcggagcttcttcc
gggattcatggcttcgcggaggagaaagagatcccggtgtggcccaagccccactcactc
ctcgccagtggctcggggtccctggcattggccgagaatttcacgctgcgctcgtcgccg
gactcgatcgcgacgctgagcagcgcattcgctcgataccgcgagattatcttcctccac
cactcgatcttcctcgcctctcgccagattcccgagagcataccacagctccaggcgctc
agcgttcgaatctcatccccggacgaaacactccaaatcggcgtggatgagtcgtatcgc
ctccaaatcccggatcccgacgatgctactgccgcattgctcacggcagagactgtgtat
ggagccctacacggattggagacgtttagccagatctgcgccttcaatttcacgacgaag
atgacggaagtgcgatacatcccagtggacatcgtcgatcggccgagatttgagtatcga
ggtctcttgattgacacttcgaggcactatgagcccctcaagattgtccggagcgtcatt
gattccatggcctacgccaagctgaatgttttgcactggcatattgtcgacacccaatcg
tttcctttggagattccttcctttcctaagctttggaatggagcgtatactggagccgag
cgctacactctagaagatgccaagggtattgtcgaatacgcgaggctaagaggaatcaat
gtgatgccagagcttgatgttcccggccatgctgcatcctggggcgtaggctatccggaa
ctgtggccctccgggaactgtacgcaacctttggatgtaagcaattttgcaaagaccttt
cctttcaaattcatgcaccttggtggtgacgaagtcgatacaacctgctggaagaagacg
cgacatatagccagatggcttgctcataacaatttcaccgccaagcaaggctacgaatac
tttgttctacgagcgcaaaagattgccctgaagtacgggcttactcccgtgaattgggaa
gagactttcaataactttggtagcaaactcaataacgagacgatcattcacaactggtct
aagctttatccttacgttttcttaggatactcacattcctggaacttacttttcaggata
ggacctggtctggcgccactcgttgtaggagcaggtttcaagtgcatcgtgagtgatcaa
gacgtgtggtatctggatcatctcgacgtaccatggcaaagcttttacaagaacgagcca
ctcacaaacataacgggagagcatgagcagagtttgataattggaggagaagtttgcatg
tggggcgaaactgtggatccaagcgacatacatcaaacaatctggcctcgagcagcagct
gcagccgaacgcttgtggtctccgaggagcttcacggaccaaggaacttcgcaagtccat
tcgaggctcaaaactttcaggtgtttgctacaacagcgagggatccctgcagctccagta
gatgagcttggccgggtgtctccgccgtatccaggttcttgttacgaccagtaa

DBGET integrated database retrieval system