KEGG   Selaginella moellendorffii: SELMODRAFT_445744Help
Entry
SELMODRAFT_445744 CDS       T01496                                 

Gene name
CYCH-2
Definition
hypothetical protein
Orthology
K06634  
cyclin H
Organism
smo  Selaginella moellendorffii
Pathway
Basal transcription factors
Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:smo00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    SELMODRAFT_445744 (CYCH-2)
  Replication and repair
   03420 Nucleotide excision repair
    SELMODRAFT_445744 (CYCH-2)
Transcription machinery [BR:smo03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     SELMODRAFT_445744 (CYCH-2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 331 aa AA seqDB search
MADFLTSTHRDRWIFTVQDLVEKASAANARAVQALQQHGATRVEIQPDGSLAYPGSENGA
PSKLPEPLKIEEELFIRRYYEHKIQQVCGAFSFPNKIQATAVLYFKRFYLSWSVMEHDPK
HIMLTCIYISCKVEEFHVSAEELGKGIQQDHQVILKNELTLLQGLNFDLIVYAPYRSLDG
FVLDIQKWADAAKDENVSQKILDLQSEAIRKVDAMLLTDCPLLFPPGQLALAALRSANVQ
ERAIDMEKYLRGVCERQQQKHSYSELVGMLNQIAALVDAARTPIEEEVRRIDRKLKFCRN
PGLQDESKKRDRKGKHKSKRTPQQETISPMA
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atggcggatttcctcacctcgacgcatcgcgatcggtggatcttcacagtgcaggacctg
gtggagaaagcgtccgcggccaatgcaagagctgtccaagcgcttcagcaacacggcgct
actcgcgttgaaatccaaccggatggatcattggcgtatcctggatcagagaatggcgct
ccaagtaaacttcccgagcctttgaagattgaggaagagctgttcattcgaaggtactac
gagcacaaaatacagcaagtttgcggagctttctcctttccaaataaaatccaggccact
gctgtgctctatttcaagcgcttttacctctcttggtctgtgatggagcacgatccaaag
catataatgctcacatgcatttacatatcgtgtaaagttgaagagtttcacgtctcagcc
gaggagcttggtaagggaatccaacaagatcaccaagtcatcctaaaaaacgaattaacg
ctgttacagggtctcaatttcgacttgattgtatatgctccctatcgatccttggacggc
tttgttttggacattcagaaatgggcggacgctgcgaaggatgagaatgtctctcagaaa
atactggacctccaaagtgaagcgattcgaaaggtggacgcaatgcttctgacggactgc
ccgctcctctttcctcctggacagctagccttggcagctctgcgaagcgcaaatgttcag
gaaagagcaatagacatggaaaagtacctgcgaggggtatgcgaacggcaacagcagaaa
cactcgtactcggagctcgtcggaatgcttaaccagatagctgcactggttgatgctgca
agaacacctatcgaagaggaagtaagacgcatcgacaggaagctaaagttttgtagaaat
ccaggactacaagacgagagtaagaaacgagaccgcaagggtaagcacaaatccaagcgg
actcctcagcaagagacaatctcaccaatggcttga

DBGET integrated database retrieval system