KEGG   Selaginella moellendorffii: SELMODRAFT_446105Help
Entry
SELMODRAFT_446105 CDS       T01496                                 

Definition
hypothetical protein
Orthology
K03253  
translation initiation factor 3 subunit B
Organism
smo  Selaginella moellendorffii
Pathway
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:smo03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 723 aa AA seqDB search
MAEVALPYRYDPQPSSPQQQPPRPGLNIDWSQVNLDEIQLPPGEDFGIKSEDEEEEEEIV
ESESGFGSIIVVDNLPVVEPAKYEKLENVVRKIFGQMGIIRTLFMPKDKATGKTSGFAFI
EYSSPQEAHTARDQADGYKLDKSHVFMVRMFDDIDKYMKVPEQWVAPEIKSYVPGENLLE
WLMDEKGRDQFVIRFGTETEVCWNDARLLKAETAYHRSFWTESFVQWSPLGTYLATIHRQ
GAVIWGGCTNFSRITRFIHQQVRLIDFSPSEKFLVTYSSHEPSNPRETQKVVLNVFDVRS
GKSHREFKGSADEFATGGTGGVAGVSWPVFRWSGGRDDKYFARIGKHCISVYETETMGLL
DKKSLKVDNVIDFSWSPTDSILALFVPEGNGGNQPARVSLVQIPGREELRQKNLFSVSDC
KMYWQSNGDYLAVKVDRYTKTKKSTYTGFELFRIKERDIPIEVLELENKNDKIIAFAWEP
KGHRFAIIHGDGPRPDVTFYSMKSPNNVDRVTKLATLKGKQANALYWSPAGRFIVLAGLK
AYNGQLEFYNVDDLETMATAEHFMATDVDWDPAGRYVATSVTSVHQMENGFIIWSFHGKL
IYKVSRDRFFQFLWRPRPPSLLSSEEEAEIFRNLKQYSKRYDQEDIESSRFHSTQELEQR
RKLIEEWNGWLSSWKQMHEADKPYRQDLRDGEPSDDEQEYEDEEVEIEEVIDVEEIKEED
LEA
NT seq 2172 nt NT seq  +upstreamnt  +downstreamnt
atggcggaggtcgccctcccataccgctacgatccacagccgtcgtcgccgcagcagcag
ccacccaggcctggcttgaacatcgactggtcgcaggtgaatctcgatgagattcagctc
cctccgggcgaggattttggaatcaagagtgaggatgaagaggaggaggaggagattgtg
gagagcgagtctggtttcgggagcataattgtcgtagacaatctcccggtggtggagcct
gccaagtatgagaagctcgaaaacgtggtacgcaagatttttggacaaatgggaattatt
agaacgctcttcatgccgaaagacaaagcgactggcaaaacgtcgggctttgctttcatc
gagtactccagtccccaggaggcccataccgctcgggatcaagccgatgggtataagctc
gacaaatctcacgtctttatggtgaggatgttcgatgacattgacaagtacatgaaagtt
cctgagcagtgggtagctccagagatcaagagctacgtgccaggggagaatcttctcgaa
tggctgatggacgagaaaggacgcgatcaatttgtgatacgatttggcacggagacagag
gtgtgctggaacgatgcccgtctgttgaaggccgagacggcatatcatcgatcgttctgg
acggaaagctttgttcaatggtctccccttgggacgtatctcgcaacaattcatcggcaa
ggtgctgtcatatggggtggatgcactaactttagccggatcactcgattcattcaccaa
caggtgcggctaattgacttctccccatccgaaaagttcctcgtaacgtacagcagccac
gaaccaagcaatccccgcgaaacacaaaaagtagtgcttaacgttttcgacgtacgaagt
ggtaaatcgcaccgagaattcaagggcagcgccgacgagtttgctactggtgggactgga
ggtgttgccggagtgtcttggccagtgttcaggtggtctggcggccgtgatgacaagtat
tttgcgcgtataggaaagcactgtataagtgtttacgagacagagaccatgggtttactg
gacaagaagtcgctgaaagttgacaatgttatagattttagctggtcaccaaccgattca
attctggccctttttgtcccagaaggcaacggtggcaatcagcctgcgagggttagcctg
gttcaaattcctggcagggaagaactgaggcagaagaaccttttcagtgtcagtgactgc
aagatgtactggcaaagcaacggagactatctagcagtcaaagttgatcggtatacaaag
acgaagaagagcacgtataccggttttgagctcttccggatcaaagaacgcgacattcct
atcgaggtcttggagcttgagaacaaaaacgacaagattatcgccttcgcatgggaacca
aagggccaccgattcgccatcattcatggagatggtcctcgtcccgacgtaacgttctac
tcgatgaagagcccaaacaacgtggaccgtgtaaccaagcttgccacgctcaaaggaaag
caggcaaatgctctctactggtcgcctgcggggcgcttcattgtgctggcgggtctcaag
gcgtataacgggcagctcgagttctacaatgttgatgatctcgagactatggcaacggca
gagcatttcatggcaactgatgtggattgggatcccgctggaagatatgtggctacttct
gttacttccgtgcaccaaatggagaacggcttcattatctggtctttccatgggaagctg
atatacaaggtttcaagggacagattcttccagttcttgtggcgccccaggcctccatct
ctccttagtagcgaagaggaagccgagatttttaggaacttgaaacagtattccaagagg
tatgaccaagaggacatagaatcgtcgaggttccacagcacccaggagttggagcagagg
aggaagctgattgaggagtggaacgggtggctgtcttcgtggaagcaaatgcacgaggcg
gacaagccttaccggcaggatcttcgtgatggcgagcccagcgacgacgagcaggagtac
gaagacgaagaggtcgagattgaggaggtgatcgacgtggaagagatcaaggaagaggac
cttgaggcgtaa

DBGET integrated database retrieval system