KEGG   Selaginella moellendorffii: SELMODRAFT_449420Help
Entry
SELMODRAFT_449420 CDS       T01496                                 

Gene name
MPK4-1
Definition
hypothetical protein
Orthology
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
smo  Selaginella moellendorffii
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 374 aa AA seqDB search
MEAAAAAAEGNFTGVLVHSGRYVQYNIFGNLFEVTAKYVPPIRPIGRGAYGIVCSAVNSE
TNEEVAIKKIGNAFDNRIDAKRTLREIKLLRHMDHENIVAIRDIIRPPSKDEFNDVYIVY
ELMDTDLHQIIRSNQQLTDDHCQYFLYQLLRGLKYVHSANVLHRDLKPSNLLLNANCDLK
ICDFGLARTTSETDYMTEYVVTRWYRAPELLLNCSEYTAAIDVWSVGCIFMELLNREPLF
PGRDYVQQLRLITELIGSPEDADLGFLRNDNARRYVRQLQRYPRQSFAHRFPNVPPLAVD
LVERMLVFNPQNRISVTEALAHPYLTNLHDVNDEPSCHGPFDFDFEQPTFSEDNIKELIY
EESLTFTTADMVTE
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atggaggcagctgctgctgccgccgaaggtaacttcaccggagtgctggttcacagcggc
cgctatgtgcaatacaacatcttcgggaacctgttcgaggtcacggccaagtacgtgccc
ccgattcgacccatcggccgtggcgcctacggcattgtgtgctctgcagtgaacagcgag
accaacgaagaagttgctatcaagaaaatcggcaatgcctttgacaacaggatcgatgcc
aagcgcacattgcgcgagatcaagctgttgcggcacatggatcacgagaatattgttgcc
atccgagatataatcaggcctccctccaaggacgagttcaacgacgtgtatatcgtgtac
gagctcatggacacggatctacaccagatcatccgctccaaccagcagctcacggacgac
cactgtcagtatttcctgtaccagctgctgcggggcctcaagtacgtgcactctgcaaac
gttctccaccgggacctcaagcccagcaatctgctcctcaacgccaactgcgacctgaaa
atctgcgactttgggctggcccggaccacatcggagaccgactacatgacagagtacgtt
gtcacccgctggtacagggcgccggagctgctcctaaactgctccgagtataccgcggcg
attgatgtatggtctgttggatgtatatttatggagcttttgaaccgagaaccattgttt
cctggcagagattacgtgcagcagctgcgtctcatcaccgagctgattggatccccagag
gacgccgacctgggattcttgaggaacgacaacgcgcggagatatgtccgccagctgcaa
cggtaccccaggcaatcctttgcgcacaggtttcctaacgtgcccccgctcgccgtcgat
ctcgtggagaggatgctcgtgttcaatccgcagaaccgaatctcagtgacagaagctctt
gcccatccatacctcacaaacctgcacgacgtcaacgacgagccgagctgccacggaccc
ttcgattttgatttcgagcagcccacattctccgaagacaacatcaaggagctcatctac
gaggagtccttgacattcaccacggcggacatggtgacggaatga

DBGET integrated database retrieval system