KEGG   Selaginella moellendorffii: SELMODRAFT_449423Help
Entry
SELMODRAFT_449423 CDS       T01496                                 

Gene name
MPK4-2
Definition
(RefSeq) hypothetical protein
Organism
smo  Selaginella moellendorffii
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 374 aa AA seqDB search
MEAAAAAAEGNFTGVLVHSGRYVQYNIFGNLFEVTAKYVPPIRPIGRGAYGIVCSAVNSE
TNEEVAIKKIGNAFDNRIDAKRTLREIKLLRHMDHENIVAIRDIIRPPSKDEFNDVYIVY
ELMDTDLHQIIRSNQQLTDDHCQYFLYQLLRGLKYVHSANVLHRDLKPSNLLLNANCDLK
ICDFGLARTTSETDYMTEYVVTRWYRAPELLLNCSEYTAAIDVWSVGCIFMELLNREPLF
PGRDYVQQLRLITELIGSPEDADLGFLRNDNARRYVRQLQRYPRQSFAHRFPNVPPLAVD
LVERMLVFNPQNRISVTEALAHPYLTNLHDVNDEPSCHGPFDFDFEQPTFSEDNIKELIY
EESLTFTTADMVTE
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atggaggcagctgctgctgccgccgaaggtaacttcaccggagtgctggttcacagcggc
cgctatgtgcaatacaacatcttcgggaacctgttcgaggtcacggccaagtacgtgccc
ccgattcgacccatcggccgtggcgcctacggcattgtgtgctctgcagtgaacagcgag
accaacgaagaagttgctatcaagaaaatcggcaatgccttcgacaacaggatcgatgcc
aagcgcacattgcgcgagatcaagctgttgcggcacatggatcacgagaatattgttgcc
atccgagatataatcaggcctccctccaaggacgagttcaacgacgtgtatatcgtgtac
gagctcatggacacggatctacaccagatcatccgctccaaccagcagctcacggacgac
cactgtcagtatttcctgtaccagctgctgcggggcctcaagtacgtgcactctgcaaac
gttctccaccgggacctcaagcccagcaatctgctcctcaacgccaactgcgacctgaaa
atctgcgactttgggctggcccggaccacatcggagaccgactacatgacagagtacgtt
gtcacccgctggtacagggcgccggagctgcttctaaactgctccgagtataccgcggcg
attgatgtatggtctgttggatgtatatttatggagcttttgaaccgagaaccattgttt
cctggcagagattacgtgcagcagctgcgtctcatcaccgagctgattggatccccagag
gacgccgacctgggattcttgaggaacgacaacgcgcggagatatgtccgccagctgcaa
cggtaccccaggcaatcctttgcgcacaggtttcctaacgtgcccccgctcgccgtcgat
ctcgtggagaggatgctcgtgttcaatccgcagaaccgaatctcagtgacagaagctctt
gcccatccatacctcacaaaccttcacgacgtcaacgacgagccgagctgccacggaccc
ttcgattttgatttcgagcagcccacattctccgaagacaacatcaaggagctcatctac
gaggagtccttgacattcaccacggcggacatggtgacggaatga

DBGET integrated database retrieval system