KEGG   Selaginella moellendorffii: SELMODRAFT_450110Help
Entry
SELMODRAFT_450110 CDS       T01496                                 

Gene name
NQK-1
Definition
MAP kinase
Orthology
K04368  
mitogen-activated protein kinase kinase 1 [EC:2.7.12.2]
Organism
smo  Selaginella moellendorffii
Brite
Enzymes [BR:smo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     SELMODRAFT_450110 (NQK-1)
Protein kinases [BR:smo01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   SELMODRAFT_450110 (NQK-1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 346 aa AA seqDB search
MRGFASNRRALRVAVPRQDTNISDFLTASGTFQDGDILLNRDGLRVVTQEPTTSPVDGQI
ALTDLEAVKVIGKGSSGVVQLVRHKWTGQVFALKAIQMNIQETMRKQIVQEIKINQSSQC
PYVVVCYEAFYNNGVISIVFEYMDGGSLLDVIKEVNALPEPYLAAICKQVLKGLVYLHLD
RRIIHRDIKPSNLLVNHKGEVKITDFGVSAVLANSMGQRDTFVGTYTYMSPERISGGAYG
FESDIWSLGLTLLECATGRFPYLPPGQENGYLNFYELLETIVEQPAPVASPEMFSAEFCS
LISACIQKEPKDRMTAAELLKHPFIQKYENEDINLAVLVPRLPPGA
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgcgcggattcgccagtaacaggagggctctcagggttgccgttcccaggcaggacaca
aacatctcggatttcctgaccgcgagtggcacatttcaagatggggacattctcctcaac
cgggatggtttgcgagttgtcactcaggagcccacgaccagccctgtggatggccaaatt
gctctcacagacttggaagctgtcaaggtgattggaaaaggcagcagtggagttgtgcag
cttgttcgtcacaaatggactggacaagtcttcgcactaaaggcgatccaaatgaacatc
caagagactatgcgaaaacaaatcgttcaggagattaagatcaaccagtcctcgcaatgc
ccctacgttgtagtttgctacgaggccttctacaacaacggagtcatttccattgttttc
gagtacatggacggaggctcgcttctggatgtgatcaaagaagtgaatgctcttcccgag
ccgtatttggcagccatttgcaagcaggtgctcaagggtctggtgtatttgcaccttgac
cgtcgtatcatccacagggatatcaagccatcaaaccttctcgtgaatcacaaaggcgag
gtgaagatcacagacttcggtgtaagtgccgtcttggcaaactccatgggacaacgagac
actttcgttggaacatacacctacatgtcgcctgagaggatcagtgggggcgcttatggc
ttcgagagcgatatttggagcttgggcttgacgctgctggaatgcgcgactggacggttc
ccatacttgcctccgggccaggagaatggatacttgaacttctacgagctgctcgagacg
attgtggagcaaccagcacccgttgcgtcgccagagatgttctcggccgagttttgctcg
ctcatatctgcgtgcatccagaaggaaccgaaggatcgaatgaccgctgccgagttgctg
aagcatccgttcatccaaaaatacgagaacgaggacatcaacttggctgtgctggttccc
aggctgccgcccggtgcttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system