KEGG   Selaginella moellendorffii: SELMODRAFT_450110Help
Entry
SELMODRAFT_450110 CDS       T01496                                 

Gene name
NQK-1
Definition
(RefSeq) MAP kinase
  KO
K04368  mitogen-activated protein kinase kinase 1 [EC:2.7.12.2]
Organism
smo  Selaginella moellendorffii
Brite
Enzymes [BR:smo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     SELMODRAFT_450110 (NQK-1)
Protein kinases [BR:smo01001]
 Serine/threonine kinases: STE group
  STE7 family
   SELMODRAFT_450110 (NQK-1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like APH Seadorna_VP7 RIO1 Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 9636652
NCBI-ProteinID: XP_002988344
JGI: 450110
UniProt: D8SYB3
Position
Unknown
AA seq 346 aa AA seqDB search
MRGFASNRRALRVAVPRQDTNISDFLTASGTFQDGDILLNRDGLRVVTQEPTTSPVDGQI
ALTDLEAVKVIGKGSSGVVQLVRHKWTGQVFALKAIQMNIQETMRKQIVQEIKINQSSQC
PYVVVCYEAFYNNGVISIVFEYMDGGSLLDVIKEVNALPEPYLAAICKQVLKGLVYLHLD
RRIIHRDIKPSNLLVNHKGEVKITDFGVSAVLANSMGQRDTFVGTYTYMSPERISGGAYG
FESDIWSLGLTLLECATGRFPYLPPGQENGYLNFYELLETIVEQPAPVASPEMFSAEFCS
LISACIQKEPKDRMTAAELLKHPFIQKYENEDINLAVLVPRLPPGA
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgcgcggattcgccagtaacaggagggctctcagggttgccgttcccaggcaggacaca
aacatctcggatttcctgaccgcgagtggcacatttcaagatggggacattctcctcaac
cgggatggtttgcgagttgtcactcaggagcccacgaccagccctgtggatggccaaatt
gctctcacagacttggaagctgtcaaggtgattggaaaaggcagcagtggagttgtgcag
cttgttcgtcacaaatggactggacaagtcttcgcactaaaggcgatccaaatgaacatc
caagagactatgcgaaaacaaatcgttcaggagattaagatcaaccagtcctcgcaatgc
ccctacgttgtagtttgctacgaggccttctacaacaacggagtcatttccattgttttc
gagtacatggacggaggctcgcttctggatgtgatcaaagaagtgaatgctcttcccgag
ccgtatttggcagccatttgcaagcaggtgctcaagggtctggtgtatttgcaccttgac
cgtcgtatcatccacagggatatcaagccatcaaaccttctcgtgaatcacaaaggcgag
gtgaagatcacagacttcggtgtaagtgccgtcttggcaaactccatgggacaacgagac
actttcgttggaacatacacctacatgtcgcctgagaggatcagtgggggcgcttatggc
ttcgagagcgatatttggagcttgggcttgacgctgctggaatgcgcgactggacggttc
ccatacttgcctccgggccaggagaatggatacttgaacttctacgagctgctcgagacg
attgtggagcaaccagcacccgttgcgtcgccagagatgttctcggccgagttttgctcg
ctcatatctgcgtgcatccagaaggaaccgaaggatcgaatgaccgctgccgagttgctg
aagcatccgttcatccaaaaatacgagaacgaggacatcaacttggctgtgctggttccc
aggctgccgcccggtgcttaa

DBGET integrated database retrieval system