KEGG   Selaginella moellendorffii: SELMODRAFT_450118Help
Entry
SELMODRAFT_450118 CDS       T01496                                 

Gene name
SnRK1.2-2
Definition
SNF1-related protein kinase, subfamily 1, 2
Orthology
K07198  
5'-AMP-activated protein kinase, catalytic alpha subunit [EC:2.7.11.11]
Organism
smo  Selaginella moellendorffii
Pathway
Regulation of autophagy
Class
Cellular Processes; Transport and catabolism; Regulation of autophagy [PATH:smo04140]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 515 aa AA seqDB search
SRRGFAMDGKANDFLNYKMGKTLGIGSFGKVKVAEHIPTGHKVAIKILNRRKIKAMDMEE
KVRREIKILRLFMHPHIIRLYEVVETANDIFVVMEYVKSGELFDYIVEKGRLQEDEARRF
FQQIISGVEYCHRNMVVHRDLKPENLLLDSRCNVKIADFGLSNIMRDGHFLKTSCGSPNY
AAPEVISGKLYAGPEVDVWSCGVILYALLCGSLPFDDENIPNLFKKIKTGLYTLPSHLSP
GAKDLIPRMLLVEPMKRMTIPEIRQHPWFQAHLPRYLAVPPLDTVEQAKRIDEDILREVT
KLGFDRNLLVDSLRTRVANTATVTYYLMLDNRRRMSHGYLIDEFQEEMASPQTGPVSAKQ
LQSPFMHIQSQRGPSPSNDISRFTAERRWALGLQSRASPRDIMNEVLKVLQDMEVLWKKN
GNYNVKCRWNSPAPCSREAVGSPMVPGSPIHDNGLEKLVEQQQQQHKIGSSLVKFELQLY
KVREEKYLLDLQKLEGPFFIFLDFCGSFLAELRVL
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
agcagacgcggtttcgcgatggacgggaaggccaacgatttcctcaactacaagatgggc
aagactcttggaatcggatcgtttggtaaggtcaaggtagccgagcacatccccactggg
cacaaggttgccatcaagatactcaatcgcaggaaaatcaaggccatggacatggaagag
aaagttagaagagagatcaagatcttgagattattcatgcatcctcacatcataaggctc
tacgaggtcgtggagaccgcgaatgatattttcgtggtgatggagtatgtcaagtcgggg
gagctattcgattatattgtcgagaaggggcgcctccaggaggacgaagcccggcgtttc
ttccagcagatcatttctggagtggaatattgtcacagaaatatggtggttcatcgtgat
ctgaagccagaaaatctgttgcttgactctaggtgcaatgtgaagattgcggactttggc
ttgagtaatatcatgcgagatggacactttctgaaaacgagctgtggaagtccaaactat
gccgctccagaggtgatctcgggaaagctttatgcaggaccagaagtggatgtatggagc
tgtggtgtcatattgtacgcacttctgtgtggaagtttaccttttgacgacgagaacatc
ccaaaccttttcaagaagatcaagacgggtttgtacacacttcccagccatctctcgccc
ggtgctaaggatttgataccacggatgctgctcgttgagccaatgaaacggatgactatt
cccgagattcgccaacatccctggttccaagctcatcttccccgataccttgcggtgcct
ccacttgatacggttgaacaagccaaacgaattgatgaggatattttgagagaagtgacc
aagcttggtttcgacagaaatctccttgtggactctctacgaactagagtggcaaacacg
gcaactgtcacttactaccttatgctggataataggcggcgaatgtcccatggttatttg
attgatgaatttcaggaggaaatggcttcccctcaaaccggaccagtatcagcgaaacaa
cttcaatcgccgtttatgcatattcaaagccagcgtggtccgtcgccttcaaacgacata
tctagatttactgccgagagaagatgggctttgggactacagtcccgagcttctccacgg
gacataatgaacgaggtgctcaaggtgctgcaagatatggaggttttgtggaagaagaac
gggaattacaacgttaagtgtcgctggaactctcccgcgccctgttccagagaagccgtc
ggctctccgatggtgccaggctctccaatccacgacaatggcttagaaaaactcgtggag
cagcagcagcagcagcacaagattggcagcagtcttgtaaaattcgagctccagttgtat
aaggtgagagaggagaagtaccttctcgacctccagaagcttgaaggcccgttttttatc
tttctcgatttttgcggctccttcctggccgagctaagggtcctttga

DBGET integrated database retrieval system