KEGG   Selaginella moellendorffii: SELMODRAFT_46268Help
Entry
SELMODRAFT_46268  CDS       T01496                                 

Definition
hypothetical protein
Orthology
K17499  
protein phosphatase 1G [EC:3.1.3.16]
Organism
smo  Selaginella moellendorffii
Brite
Enzymes [BR:smo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     SELMODRAFT_46268
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 272 aa AA seqDB search
LKAAKREKVSQDVEGPYCKIGVSCMQGWRWFMEDAHAVLADLDTRGMAYVGVFDSHISPR
AAQFCAQNMHARVLDRSSPDDLDLVLHKSFMDMDRDFRGTIKDPSNPDSVFRAGGCTATV
LLLSDRGTKVTVAGVGDCRCVASRAGMAEELSRDHKPDLPDERERIEAAGGSVTFGRLKD
LNVSRGIGDYRLKIPVDLPPERQQLSAAPEIREAKVVGDPGIEFVVVASDGVWECRSSQE
VVDFVRGKLMESESQGGPLVSRICEELMDSCV
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
ttgaaagcagcaaagcgcgagaaggtgtcacaggatgtggaaggcccctactgtaagatc
ggtgtgtcgtgtatgcagggatggcgctggttcatggaggatgctcacgccgtccttgcc
gaccttgacactagaggtatggcatacgtgggagtcttcgattcccacatctctccaaga
gcagcccagttctgcgcccaaaacatgcatgctcgcgtcctagatcgctcttctcccgat
gatctcgacctcgtcctccacaagtccttcatggacatggatcgggatttccggggcacc
ataaaggacccatcgaatccagactcggtgtttcgtgccgggggctgcacggccacggtg
ctgctgctgagcgaccgcggcacaaaggtgacggtggcaggtgtgggcgattgccggtgc
gtggcttccagggccgggatggcggaagagctgagccgggatcacaaaccggacctccct
gacgagagagagcgcatcgaggccgcgggtggcagcgttactttcggacggctcaaggat
ctcaacgtgagcaggggcatcggggactaccgcctcaagatcccggtcgaccttccgccc
gagaggcagcagctgagcgcagcaccggagatcagggaggcgaaggtggttggtgatccg
gggattgagtttgtggtggttgcgtcggatggtgtttgggagtgccgatccagccaggag
gtggtggactttgtgcgtggcaagctgatggagagtgagagccaaggagggccattggta
tcaaggatttgcgaggagcttatggattcttgtgtt

DBGET integrated database retrieval system