KEGG   Selaginella moellendorffii: SELMODRAFT_61474Help
Entry
SELMODRAFT_61474  CDS       T01496                                 

Definition
hypothetical protein
Orthology
K12309  
beta-galactosidase [EC:3.2.1.23]
Organism
smo  Selaginella moellendorffii
Pathway
Galactose metabolism
Other glycan degradation
Glycosaminoglycan degradation
Sphingolipid metabolism
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smo00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    SELMODRAFT_61474
  Lipid metabolism
   00600 Sphingolipid metabolism
    SELMODRAFT_61474
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    SELMODRAFT_61474
   00604 Glycosphingolipid biosynthesis - ganglio series
    SELMODRAFT_61474
   00511 Other glycan degradation
    SELMODRAFT_61474
Enzymes [BR:smo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     SELMODRAFT_61474
Exosome [BR:smo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SELMODRAFT_61474
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 620 aa AA seqDB search
SRSFSIENDAFYKDGEPFRILGGEIHYFRIVPEYWKDRIQRAKAMGLNTIQTYVPWNVHE
PSEGEFFFGDPVNLEAFLKLAQELEVLVMLRMGPYVCGEWDLGGFPSWLLSKQPQLKLRT
SDSSYLKLVDQWWNVLLPKLVPFLYSRGGPVIMLQVENEYGSFGSDKQYLHHLVSEAREY
LGNEIILYTTDGATEDALQRGTISRDDVYAAVDFPTGWDPVAAFALQKNYNSPGKSPALS
TEFYTGWLTHWGENLATTSPYVAAAELDKLLSANGSVVLYMAHGGSNFGFFSGANTGGKE
TIYQPDITSYDYDAPIGEGGDLGEKFWRFREVLSSYVNFPLPDPPQLPSRRNTGTVVLQK
LANLFQVLQSLSHEFYLQQAPVTMELLNQSFGFIVYRSRLPSHAKPGSILEIKKIHDRAQ
VYVGKSSQSLRLVGTLQRWSNSSLQLPDGSSAGMEIYILVENMGRINYGPFIFDQKGILS
SVILDNVPMLGWRAYTLSLADVAENQEVLINFAIHSKFFFLSLAAPHCDGPAFYAATFES
EAQMDTFISFKGWSKGVAFVNGFNLGRFWPDAGPQCSLYVPGPLLRQGENQLLILELENT
LLHNKTLQFLGQHDWTCGKN
NT seq 1860 nt NT seq  +upstreamnt  +downstreamnt
tccagaagtttttctatagaaaacgacgcgttttacaaggatggagagcccttccgcatt
ctgggtggtgaaatccactacttccggatcgttccagagtactggaaagaccggatccag
cgagcaaaagcaatgggtcttaacaccatccagacttacgttccttggaatgttcacgag
ccatcggaaggcgagttcttctttggcgatccggtgaacctcgaggcctttctaaagctc
gcacaagagctcgaagttttggtcatgcttcgcatgggaccatatgtttgtggagaatgg
gaccttggaggatttccttcgtggctactgtccaaacaaccacagctaaagctcaggact
tccgattcttcgtaccttaagctcgttgaccaatggtggaatgttcttcttcctaaactc
gttccatttctctactctcgtggtggtccagtgatcatgctacaggttgaaaacgagtat
ggatctttcggatctgacaagcagtatctccaccaccttgtcagcgaagctcgcgaatac
ttgggaaacgaaataatcctatacacgactgatggagctacagaggacgctctgcaacgg
ggtacaatatctagagacgatgtttatgctgctgtggattttcccaccggctgggatcct
gtagcagcatttgcactacaaaagaactacaactcccctggaaagtctcctgcattgtca
actgagttttacacgggctggcttactcactggggagaaaatctcgcaacaacaagcccg
tatgttgcagcagcagagctggacaagcttttgagtgctaatggttctgtcgtgctttat
atggctcacggaggctccaactttggatttttcagcggtgcaaatactggggggaaagaa
accatctatcagccggatatcacgtcctatgattatgacgcccccattggggaaggtgga
gatcttggagaaaagttttggagatttcgtgaagtgctctcgagctatgtcaactttcca
cttccagatccgccgcaacttccatcgagacgaaacactgggactgtcgtgctgcaaaag
ctcgcaaatcttttccaagtcctccagtctctcagtcatgaattctatcttcaacaagct
ccggtgaccatggagcttctcaaccagagttttggattcatcgtttatagatccagactc
ccgtctcatgcaaaaccaggatccatccttgaaataaagaagattcatgatcgagctcaa
gtttacgttggaaagagctctcaaagcctgagactcgtaggaacgctgcaaagatggtcc
aattcctcgctacaacttcctgatggatcatcggctggaatggaaatctacattttggtg
gaaaacatgggacgtatcaactatggaccattcatattcgaccaaaaggggattctttct
tccgttatccttgacaatgttccaatgcttggctggagagcttacactttaagcctcgca
gatgtcgctgaaaatcaagaggttttaatcaactttgccatacactcaaagtttttcttt
ctttctttggcagctccacattgtgatggccctgctttctatgctgccacgtttgagagt
gaagctcaaatggacactttcatctctttcaaaggctggagcaaaggggtggcgttcgtg
aatggtttcaaccttggtcgattttggccggatgctggcccgcaatgcagcctgtatgtt
cctggaccactgctaaggcaaggagaaaaccagcttttgattctagagctcgaaaacact
ctgctccacaacaaaacgctccagtttctcgggcagcacgactggacttgcggcaaaaac

DBGET integrated database retrieval system