KEGG   Selaginella moellendorffii: SELMODRAFT_61474Help
Entry
SELMODRAFT_61474  CDS       T01496                                 

Definition
hypothetical protein
Orthology
K12309  
beta-galactosidase [EC:3.2.1.23]
Organism
smo  Selaginella moellendorffii
Pathway
Galactose metabolism
Other glycan degradation
Glycosaminoglycan degradation
Sphingolipid metabolism
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:smo00052]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:smo00600]
Metabolism; Glycan biosynthesis and metabolism; Glycosaminoglycan degradation [PATH:smo00531]
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - ganglio series [PATH:smo00604]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:smo00511]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 620 aa AA seqDB search
SRSFSIENDAFYKDGEPFRILGGEIHYFRIVPEYWKDRIQRAKAMGLNTIQTYVPWNVHE
PSEGEFFFGDPVNLEAFLKLAQELEVLVMLRMGPYVCGEWDLGGFPSWLLSKQPQLKLRT
SDSSYLKLVDQWWNVLLPKLVPFLYSRGGPVIMLQVENEYGSFGSDKQYLHHLVSEAREY
LGNEIILYTTDGATEDALQRGTISRDDVYAAVDFPTGWDPVAAFALQKNYNSPGKSPALS
TEFYTGWLTHWGENLATTSPYVAAAELDKLLSANGSVVLYMAHGGSNFGFFSGANTGGKE
TIYQPDITSYDYDAPIGEGGDLGEKFWRFREVLSSYVNFPLPDPPQLPSRRNTGTVVLQK
LANLFQVLQSLSHEFYLQQAPVTMELLNQSFGFIVYRSRLPSHAKPGSILEIKKIHDRAQ
VYVGKSSQSLRLVGTLQRWSNSSLQLPDGSSAGMEIYILVENMGRINYGPFIFDQKGILS
SVILDNVPMLGWRAYTLSLADVAENQEVLINFAIHSKFFFLSLAAPHCDGPAFYAATFES
EAQMDTFISFKGWSKGVAFVNGFNLGRFWPDAGPQCSLYVPGPLLRQGENQLLILELENT
LLHNKTLQFLGQHDWTCGKN
NT seq 1860 nt NT seq  +upstreamnt  +downstreamnt
tccagaagtttttctatagaaaacgacgcgttttacaaggatggagagcccttccgcatt
ctgggtggtgaaatccactacttccggatcgttccagagtactggaaagaccggatccag
cgagcaaaagcaatgggtcttaacaccatccagacttacgttccttggaatgttcacgag
ccatcggaaggcgagttcttctttggcgatccggtgaacctcgaggcctttctaaagctc
gcacaagagctcgaagttttggtcatgcttcgcatgggaccatatgtttgtggagaatgg
gaccttggaggatttccttcgtggctactgtccaaacaaccacagctaaagctcaggact
tccgattcttcgtaccttaagctcgttgaccaatggtggaatgttcttcttcctaaactc
gttccatttctctactctcgtggtggtccagtgatcatgctacaggttgaaaacgagtat
ggatctttcggatctgacaagcagtatctccaccaccttgtcagcgaagctcgcgaatac
ttgggaaacgaaataatcctatacacgactgatggagctacagaggacgctctgcaacgg
ggtacaatatctagagacgatgtttatgctgctgtggattttcccaccggctgggatcct
gtagcagcatttgcactacaaaagaactacaactcccctggaaagtctcctgcattgtca
actgagttttacacgggctggcttactcactggggagaaaatctcgcaacaacaagcccg
tatgttgcagcagcagagctggacaagcttttgagtgctaatggttctgtcgtgctttat
atggctcacggaggctccaactttggatttttcagcggtgcaaatactggggggaaagaa
accatctatcagccggatatcacgtcctatgattatgacgcccccattggggaaggtgga
gatcttggagaaaagttttggagatttcgtgaagtgctctcgagctatgtcaactttcca
cttccagatccgccgcaacttccatcgagacgaaacactgggactgtcgtgctgcaaaag
ctcgcaaatcttttccaagtcctccagtctctcagtcatgaattctatcttcaacaagct
ccggtgaccatggagcttctcaaccagagttttggattcatcgtttatagatccagactc
ccgtctcatgcaaaaccaggatccatccttgaaataaagaagattcatgatcgagctcaa
gtttacgttggaaagagctctcaaagcctgagactcgtaggaacgctgcaaagatggtcc
aattcctcgctacaacttcctgatggatcatcggctggaatggaaatctacattttggtg
gaaaacatgggacgtatcaactatggaccattcatattcgaccaaaaggggattctttct
tccgttatccttgacaatgttccaatgcttggctggagagcttacactttaagcctcgca
gatgtcgctgaaaatcaagaggttttaatcaactttgccatacactcaaagtttttcttt
ctttctttggcagctccacattgtgatggccctgctttctatgctgccacgtttgagagt
gaagctcaaatggacactttcatctctttcaaaggctggagcaaaggggtggcgttcgtg
aatggtttcaaccttggtcgattttggccggatgctggcccgcaatgcagcctgtatgtt
cctggaccactgctaaggcaaggagaaaaccagcttttgattctagagctcgaaaacact
ctgctccacaacaaaacgctccagtttctcgggcagcacgactggacttgcggcaaaaac

DBGET integrated database retrieval system