KEGG   Selaginella moellendorffii: SELMODRAFT_61966Help
Entry
SELMODRAFT_61966  CDS       T01496                                 

Definition
hypothetical protein
Orthology
K11835  
ubiquitin carboxyl-terminal hydrolase 4/11/15 [EC:3.4.19.12]
Organism
smo  Selaginella moellendorffii
Brite
Enzymes [BR:smo01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     SELMODRAFT_61966
Peptidases [BR:smo01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   SELMODRAFT_61966
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 567 aa AA seqDB search
GSRGLAGLQNLGNTCFMNSALQCLAHTPELVEYFLQDYDDEINPANPLGMEGELAVAFGE
LIRKLWAGREVVVPRPFKNKLSRFAPQFSGYNQHDSQELLAFLLDGLHEDLNRVKSKPYI
EVKDIDGRPDGEVADEYWAIHKARNNSIIVDLFQGQYKSTLVCPVCAKVSVTFDPFMYLS
LPLPEKQQLMSVAVTVFSGDGSASPEVHTVQIPGPKQARPKDLIHALSVACTLEENEYLF
VVEVYNNRIYRVISECPSAPLSLANGDRLAAFRLKSFPGKTTKLILYHGTLEEHVTYEFS
CRTIGKQFKLYGSPLVTAIPEAGLSEGAELYNLVAKVVSPLRREAEVNSSPEDWPFRLFI
TDDKASTVDLLIDPHMPLPTFNFSPREHRYLILVWSPSAKDQYGFKELENLAPVTIPDSR
RREPISLYACLEAFMREEPLGPDDMWFCPKCKEHRQASKKLDLWRLPEILVVHLKRFSYS
RYSNKLETLVDFPVHDLDLSKYVSHRTDPYELFAVSNHYGGVGGGHYTAYAKLCNENKWY
NFDDSCVNPMSPDSIKTTAAYVLFYRR
NT seq 1701 nt NT seq  +upstreamnt  +downstreamnt
ggcagcaggggtctcgctggcctccagaatctcgggaacacttgcttcatgaacagtgcg
ctccagtgcctggctcacactccggagctcgtggagtacttcctccaggattatgatgac
gagatcaatccggcgaacccactcgggatggagggtgaactggctgtggcgtttggagag
cttataaggaagctatgggcaggaagagaagttgtcgtgccgcgtccgttcaaaaacaag
ctttctcgattcgctccacagtttagtggatacaatcaacatgattcgcaggagctcctg
gcctttcttctggatggactgcacgaagatttgaatcgcgtaaaatcaaagccatatatt
gaagttaaagatattgatggacgaccggatggagaggttgcagatgagtactgggcaatc
cataaggcgcgcaacaactcgattattgtggaccttttccagggacaatacaaatcgact
ttggtctgccccgtttgcgcgaaagtatcggttacatttgaccccttcatgtatctatcc
ttgccgttaccagagaaacaacaactgatgagcgtagcagtcacggtgttcagtggagat
gggagtgcttctccggaggttcatacggttcaaatacccggacccaagcaagcacgtcct
aaggatcttattcacgcattaagcgtggcttgcactctagaagaaaacgaatatctgttc
gttgtggaggtatataataatcggatctatcgtgtaatttctgaatgtcccagtgctcca
ctttcactagctaatggggatcgtctggctgcgtttaggctaaagtcgttccctggcaaa
acaacgaagcttattctttaccatggcactcttgaggagcatgtaacatatgaattttcg
tgcaggacaataggaaagcagtttaagctttatggttctccacttgtcactgccatacct
gaagcggggcttagtgagggtgctgagctttacaatctcgttgccaaggttgtgagtccg
ttgaggcgggaagccgaagtgaacagttctccggaagattggccatttcgtttgtttata
acagatgacaaggcctctacggtggatctgctaatagacccacatatgccactccctacg
ttcaacttttcgccgagagaacacagatatttgattttagtatggtccccaagcgctaag
gatcagtatggcttcaaagagctagagaacctggctccagtaactatccccgattcaaga
aggcgagaaccaatatccttgtacgcttgcctagaggcattcatgagagaggaacctttg
ggaccggatgacatgtggttctgcccgaaatgtaaagaacaccgtcaagcaagcaagaag
ctggatctctggaggttgccagagattctggtggtccacctgaaaaggttctcttacagt
cggtactcaaacaagctggaaacgctggtggacttccctgtgcacgacttggatttgagc
aagtacgtatcacaccggacagatccatacgagcttttcgccgtgagcaatcactacgga
ggcgtgggtggcggtcattacactgcatatgcaaagttgtgcaacgagaacaaatggtac
aactttgacgacagctgcgttaatcccatgagccccgattccataaaaacaacggcagcg
tatgtcctgttctacaggaga

DBGET integrated database retrieval system