KEGG   Selaginella moellendorffii: SELMODRAFT_63572Help
Entry
SELMODRAFT_63572  CDS       T01496                                 

Definition
hypothetical protein
Orthology
K12655  
OTU domain-containing protein 5 [EC:3.4.19.12]
Organism
smo  Selaginella moellendorffii
Brite
Enzymes [BR:smo01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     SELMODRAFT_63572
Peptidases [BR:smo01002]
 Cysteine Peptidases
  Family C85: DUBA deubiquitinylating enzyme
   SELMODRAFT_63572
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 390 aa AA seqDB search
PSVPAAASECGNQEPPRSNAGTSSSTRVGTGSRRATVPRPGFTAQRVRISPTSSHSTSPR
AHSGEGDGYNSADESSSWSATPGFEEDEDKESHFEIELRRVKGFEVRRMVPDGNCLFRAV
ADQVYGDPEMFGETRQMCIDYMERERDHFSQFITEGFTTYCKRKRRDKVYGNNLEIQAMA
EMYNRPIHIYSYSTDPINIFHGQYETDLPPIRLSYHRRNHYNSLHDPSRPAVGAGLGFGS
LRGNNVDRDQVKAAIRAQQDQQIENALLAEGRFYSDLELTEQEIERMVMEASRAEYLAEE
HHRQITHSSEETSSSAAGGPSSSGVSLTDSAAINRSSNVRVLLSMGFSYFRVMEACSIFG
DDVNNMLCYLLETEALKGESMYRMKGKAAE
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
ccgagcgttccggcagcagcttccgagtgtggtaaccaagaaccgcctagatctaacgca
ggaacttcgtcatcaactagagttggaacaggctcaaggcgtgccacagttccaaggcca
ggttttactgctcagcgagtcaggatctcgccaacgagctcgcattccacgtctcctaga
gcacactcgggggagggcgatggatacaacagtgctgacgaatccagttcctggtctgca
acgcctggatttgaggaagatgaggacaaggaaagccatttcgagatcgagctccggcgg
gtgaaaggtttcgaagtaaggagaatggttcctgatggcaactgtttgttccgtgctgtg
gctgatcaagtctatggcgatccagaaatgtttggcgagacaaggcagatgtgtatagat
tacatggaaagagaaagagatcatttttcacagttcattacagaaggctttactacgtac
tgcaaaagaaaacgcagagataaggtttatggcaacaacctcgagatacaggcaatggct
gaaatgtacaaccggccaattcacatctattcgtacagcacagatccgataaacatattt
catggacagtatgaaactgacttgccgccaatccggctaagctatcaccgtcgaaatcac
tacaattcgcttcacgatccatcacggcctgctgttggagccggacttggttttggaagc
cttcgtggtaacaatgttgacagagatcaggtgaaggctgctatccgcgcacaacaggac
caacagattgaaaacgctcttttggccgaaggccggttctactccgacttggaactgacc
gagcaagagatcgaaaggatggtgatggaggcttctcgagcggagtaccttgccgaggag
caccaccggcaaatcacgcactcgtccgaggagacgtcctcttcggccgcgggaggacca
tcatcttctggagtaagtctcacagactctgccgcgataaacaggagcagcaacgtccgc
gtcctcctgtccatgggatttagctacttccgggtgatggaggcgtgtagcatcttcggg
gacgacgtgaacaacatgctgtgctacttgctggagacggaggctctcaagggggagagc
atgtataggatgaaagggaaggccgccgag

  All links  
No link information was found.   
DBGET integrated database retrieval system