KEGG   Selaginella moellendorffii: SELMODRAFT_63572Help
Entry
SELMODRAFT_63572  CDS       T01496                                 

Definition
hypothetical protein
Orthology
K12655  
OTU domain-containing protein 5 [EC:3.1.2.15]
Organism
smo  Selaginella moellendorffii
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 390 aa AA seqDB search
PSVPAAASECGNQEPPRSNAGTSSSTRVGTGSRRATVPRPGFTAQRVRISPTSSHSTSPR
AHSGEGDGYNSADESSSWSATPGFEEDEDKESHFEIELRRVKGFEVRRMVPDGNCLFRAV
ADQVYGDPEMFGETRQMCIDYMERERDHFSQFITEGFTTYCKRKRRDKVYGNNLEIQAMA
EMYNRPIHIYSYSTDPINIFHGQYETDLPPIRLSYHRRNHYNSLHDPSRPAVGAGLGFGS
LRGNNVDRDQVKAAIRAQQDQQIENALLAEGRFYSDLELTEQEIERMVMEASRAEYLAEE
HHRQITHSSEETSSSAAGGPSSSGVSLTDSAAINRSSNVRVLLSMGFSYFRVMEACSIFG
DDVNNMLCYLLETEALKGESMYRMKGKAAE
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
ccgagcgttccggcagcagcttccgagtgtggtaaccaagaaccgcctagatctaacgca
ggaacttcgtcatcaactagagttggaacaggctcaaggcgtgccacagttccaaggcca
ggttttactgctcagcgagtcaggatctcgccaacgagctcgcattccacgtctcctaga
gcacactcgggggagggcgatggatacaacagtgctgacgaatccagttcctggtctgca
acgcctggatttgaggaagatgaggacaaggaaagccatttcgagatcgagctccggcgg
gtgaaaggtttcgaagtaaggagaatggttcctgatggcaactgtttgttccgtgctgtg
gctgatcaagtctatggcgatccagaaatgtttggcgagacaaggcagatgtgtatagat
tacatggaaagagaaagagatcatttttcacagttcattacagaaggctttactacgtac
tgcaaaagaaaacgcagagataaggtttatggcaacaacctcgagatacaggcaatggct
gaaatgtacaaccggccaattcacatctattcgtacagcacagatccgataaacatattt
catggacagtatgaaactgacttgccgccaatccggctaagctatcaccgtcgaaatcac
tacaattcgcttcacgatccatcacggcctgctgttggagccggacttggttttggaagc
cttcgtggtaacaatgttgacagagatcaggtgaaggctgctatccgcgcacaacaggac
caacagattgaaaacgctcttttggccgaaggccggttctactccgacttggaactgacc
gagcaagagatcgaaaggatggtgatggaggcttctcgagcggagtaccttgccgaggag
caccaccggcaaatcacgcactcgtccgaggagacgtcctcttcggccgcgggaggacca
tcatcttctggagtaagtctcacagactctgccgcgataaacaggagcagcaacgtccgc
gtcctcctgtccatgggatttagctacttccgggtgatggaggcgtgtagcatcttcggg
gacgacgtgaacaacatgctgtgctacttgctggagacggaggctctcaagggggagagc
atgtataggatgaaagggaaggccgccgag

DBGET integrated database retrieval system