KEGG   Selaginella moellendorffii: SELMODRAFT_70574Help
Entry
SELMODRAFT_70574  CDS       T01496                                 

Definition
hypothetical protein
Orthology
K08866  
serine/threonine-protein kinase TTK/MPS1 [EC:2.7.12.1]
Organism
smo  Selaginella moellendorffii
Brite
Enzymes [BR:smo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     SELMODRAFT_70574
Protein kinases [BR:smo01001]
 Serine/threonine protein kinases: Other group
  TTK family
   SELMODRAFT_70574
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 344 aa AA seqDB search
EELHSLRSQQQEVKVAEGANVHDKVVTESKESDSSRGKTRENANFVWVNNKRYQKLGKIG
SGGSSHVFKVIAQDCTIYALKRIILKGRDHQTACGFHQEIEYLERLKGKNHIIQLIDYEV
TDKTIFRSDSAAAHGEILNDVRIYMVLEYGEIDLARILERKKSEDGQLDENWLRLHWEHI
LKAVNTIHEERIVHADLKPANFLLVQGALKLIDFGIAKAIQNDTTNIVRESQVGTLNYMS
PEAFLMNSRDEQGTVKCGRASDIWSLGCILYQMVYGRTPFSHLSFYQKIREITNENHVIN
FPPVSNPLIVDVMKSCLMWDKDKRPRIPQLLEHAFLKPRPPPPP
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
gaagagcttcacagcttgcggtcacagcagcaggaagtgaaagttgccgagggtgccaat
gttcacgacaaagttgtcacagagagcaaggagagtgattcttctcgcggcaagacaaga
gagaatgcgaactttgtgtgggtgaacaacaagaggtatcagaagcttgggaaaatcgga
agcggtggaagcagtcacgtattcaaagtcatcgcccaagactgcacaatttacgctctc
aagaggatcatcttgaaaggacgggatcatcagacagcttgcggttttcatcaggagatc
gaatacttggagcgtctgaaaggaaagaatcacattatccaacttatagattacgaggtg
accgataaaaccatcttcaggtccgatagtgctgctgcccatggtgaaatccttaacgac
gtgcggatttacatggtgctggagtacggagagattgacttagcacgcattcttgagcgg
aagaaaagcgaggatggacagcttgatgagaattggttgcggttgcattgggagcatatc
ttgaaagctgtgaatacaatacacgaagagcggatcgtccatgccgacctcaagcccgcg
aactttctcctcgtccaaggagctctcaagcttatcgactttgggatcgccaaagccata
caaaacgacacaaccaacatcgtgcgagagtctcaggttgggaccctcaactacatgtcc
ccggaagcgttcctcatgaactcgagggacgagcagggaaccgtcaagtgtggtcgcgcg
tcagacatatggtcgcttggatgcatcctttaccagatggtttacggccggacaccattc
tcccacctcagtttttaccagaagatccgagagatcaccaacgagaaccatgtaatcaac
ttcccgccagtgtccaacccgctcatcgtggacgtgatgaagagctgccttatgtgggac
aaggacaagcggccgaggataccccagctcttggagcacgcattcctcaagccaaggccg
ccgccaccgcca

DBGET integrated database retrieval system