KEGG   Selaginella moellendorffii: SELMODRAFT_73442Help
Entry
SELMODRAFT_73442  CDS       T01496                                 

Definition
(RefSeq) hypothetical protein
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
smo  Selaginella moellendorffii
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:smo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SELMODRAFT_73442
   01230 Biosynthesis of amino acids
    SELMODRAFT_73442
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SELMODRAFT_73442
   00051 Fructose and mannose metabolism
    SELMODRAFT_73442
   00562 Inositol phosphate metabolism
    SELMODRAFT_73442
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    SELMODRAFT_73442
Enzymes [BR:smo01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     SELMODRAFT_73442
Exosome [BR:smo04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   SELMODRAFT_73442
  Exosomal proteins of bladder cancer cells
   SELMODRAFT_73442
  Exosomal proteins of melanoma cells
   SELMODRAFT_73442
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 254 aa AA seqDB search
MPRKFCVGGNWKCNGTVEEIKKIVNTLNAAADVPGEDVVEVVIGPPFVYIPLVKSILRPD
FAIAGQNCWVKKGGAFTGEISAEMFKDLAIPWVILGHSERRALCGESNEFVADKVVYALS
QGLKVMACVGETLQQRESGQTNDVVAAQTKAIADKVKDWKNVVIAYEPVWAIGTGKVATP
AQAQEVHAALRSWLEKNVSSDVASKTRILYGGSVTAANCVEIGSQPDVDGFLVGGAALKP
EFVDIIKAANVKKK
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgcctcgcaagttttgtgtcggtggcaactggaaatgcaacggaactgtggaggagatc
aagaagattgttaatactttgaatgcagctgccgatgttcctggagaggacgttgttgag
gtggtcatcggcccgccatttgtatatattcccctcgtcaagagcattctccgcccggac
ttcgccatcgccggacaaaactgctgggtgaagaaaggtggagctttcactggcgagatc
agcgccgagatgtttaaggacttggcgatcccgtgggttatcctgggacactccgaaaga
agagctttgtgtggagagagcaacgagtttgttgcagacaaggttgtttacgcattgagt
caagggctcaaagtcatggcctgcgttggtgaaacgctccagcaaagagaatccggccaa
acaaacgacgttgttgctgctcaaaccaaggcgatcgcagacaaggtcaaggactggaag
aatgtggtgatagcatacgagccagtgtgggcgattggaacaggaaaagttgccacccct
gcgcaggcccaggaggtccatgccgcacttcgctcctggctggagaagaatgtcagctct
gatgtagcaagcaagacgaggatactctacggaggttctgtgacagcagccaactgcgtg
gaaatcggctcgcagccggatgtggatggattcctcgttggtggcgctgctctcaagccc
gagttcgtggacatcatcaaggcagctaacgtgaagaagaagtag

DBGET integrated database retrieval system