KEGG   Selaginella moellendorffii: SELMODRAFT_73442Help
Entry
SELMODRAFT_73442  CDS       T01496                                 

Definition
hypothetical protein
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
smo  Selaginella moellendorffii
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Class
Metabolism; Overview; Carbon metabolism [PATH:smo01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:smo01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:smo00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:smo00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:smo00562]
Metabolism; Energy metabolism; Carbon fixation in photosynthetic organisms [PATH:smo00710]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 254 aa AA seqDB search
MPRKFCVGGNWKCNGTVEEIKKIVNTLNAAADVPGEDVVEVVIGPPFVYIPLVKSILRPD
FAIAGQNCWVKKGGAFTGEISAEMFKDLAIPWVILGHSERRALCGESNEFVADKVVYALS
QGLKVMACVGETLQQRESGQTNDVVAAQTKAIADKVKDWKNVVIAYEPVWAIGTGKVATP
AQAQEVHAALRSWLEKNVSSDVASKTRILYGGSVTAANCVEIGSQPDVDGFLVGGAALKP
EFVDIIKAANVKKK
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgcctcgcaagttttgtgtcggtggcaactggaaatgcaacggaactgtggaggagatc
aagaagattgttaatactttgaatgcagctgccgatgttcctggagaggacgttgttgag
gtggtcatcggcccgccatttgtatatattcccctcgtcaagagcattctccgcccggac
ttcgccatcgccggacaaaactgctgggtgaagaaaggtggagctttcactggcgagatc
agcgccgagatgtttaaggacttggcgatcccgtgggttatcctgggacactccgaaaga
agagctttgtgtggagagagcaacgagtttgttgcagacaaggttgtttacgcattgagt
caagggctcaaagtcatggcctgcgttggtgaaacgctccagcaaagagaatccggccaa
acaaacgacgttgttgctgctcaaaccaaggcgatcgcagacaaggtcaaggactggaag
aatgtggtgatagcatacgagccagtgtgggcgattggaacaggaaaagttgccacccct
gcgcaggcccaggaggtccatgccgcacttcgctcctggctggagaagaatgtcagctct
gatgtagcaagcaagacgaggatactctacggaggttctgtgacagcagccaactgcgtg
gaaatcggctcgcagccggatgtggatggattcctcgttggtggcgctgctctcaagccc
gagttcgtggacatcatcaaggcagctaacgtgaagaagaagtag

DBGET integrated database retrieval system