KEGG   Selaginella moellendorffii: SELMODRAFT_73545Help
Entry
SELMODRAFT_73545  CDS       T01496                                 

Definition
hypothetical protein
Organism
smo  Selaginella moellendorffii
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 334 aa AA seqDB search
MKRASSNLVRKISSAVEWSTLVDGQNRVTGASLTLIRERAHLKAEQVRAAGGAKATSCLL
GVPLGHNSSFLQGPAFAPPRIREAIWCGSTNSTTEAGKELADIRILTDVGDVQIQEMRSC
GVEDEALMQIISDSVKLVMDQPPLTPLILGGDHSISYPVVRAVTEHLGGPVDVLHLDAHP
DIYHAFEGNKFSHASSFARIMEGGHARRLLQVGLRSINKEGRDQGQKYGVEQYEMRHFSK
DKEKLQNLKLGEGVKGVYISIDVDCLDPAFAPGVSHIEPGGLSFRDVMDIVQNLEGNIVG
ADVVEFNPQRDTVDGMTAMVAAKLVRELTAKMSK
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgaagagagcgtcgagcaatctcgtgaggaaaatctcgtcggcggtggaatggagcact
ctcgtcgatggccagaatagagtgaccggcgcctcgctcactctgatccgcgagcgtgcg
catctcaaggccgagcaagttcgtgctgccggcggtgctaaagccacatcgtgcctgctg
ggagtccctcttggtcacaattcttccttcttgcaaggtcccgcatttgcccctcctcgc
attcgcgaggctatctggtgtggtagtacgaactccaccaccgaggcaggcaaggagctt
gcggacattcggatcttgacggatgtaggggacgtccaaatccaagagatgcgaagttgc
ggtgtggaagacgaagctctgatgcaaatcatcagtgattctgtcaagctcgtcatggac
cagcccccactgacgcctttgattctgggaggcgatcattccatctcgtatcccgtggtg
cgtgctgttacagagcatctcggcggtcctgtcgacgtgttacatttggatgctcatccg
gatatctatcacgctttcgaaggaaacaagttctctcacgcatcctcgtttgcgagaatc
atggagggtggccatgcaaggcggctactacaggttggactacgatcgataaacaaagaa
gggagagaccagggccaaaagtatggagtcgagcagtacgaaatgagacacttcagcaag
gacaaagaaaagcttcaaaatctgaaacttggtgagggcgtgaaaggagtctatatctcg
atcgacgtcgactgcctggatccggcttttgctcccggcgtctcccacatcgagcccggc
ggcctttctttccgagacgtgatggacatcgtccagaacctcgaaggcaacattgttggc
gcggacgttgtcgagtttaatccacagcgggacactgtcgacgggatgaccgcaatggtc
gcagccaagctcgtccgcgagctcacagccaagatgtccaagtaa

DBGET integrated database retrieval system