KEGG   Selaginella moellendorffii: SELMODRAFT_75187Help
Entry
SELMODRAFT_75187  CDS       T01496                                 

Definition
hypothetical protein
Orthology
K11858  
ubiquitin carboxyl-terminal hydrolase 48 [EC:3.1.2.15]
Organism
smo  Selaginella moellendorffii
Brite
Enzymes [BR:smo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     SELMODRAFT_75187
Peptidases [BR:smo01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   SELMODRAFT_75187
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 1009 aa AA seqDB search
RRIHLTKIVTEEDLRWFFHLDRPACQGCRGNTKDNPLCLCGLVPPANGTRKHGLWQKLSD
IIDELGPDPSRELRVMDIPAGLTNLGATCYVNSVLQCLFMNTTFRNGVFSAEMELVRNDP
VLHQLARLFAQLHSGTKSSVDSAAFATTLELDNAVQQDGQEFLKLLLTLLERVLAQSRVP
EARDVVQNLFRGTFSYVTKCSSCGKESGASDQFVDFYELEVNVKGFSSLEESLDDYLNEE
KLSGENQYFCEYCKARVDATHSTKLRLLPPVLNFQLKRFVFNLKTSTKKKVTSKFMFPKV
LDMERRVSPVTSDGSPGEPAHYDLFAILMHKGNMASSGHYVVHIRDERTGQWWQFDDEEV
TMLGSNPLGEPTSKLDKVSPDRDDNLLMSPDAYMLMFSRRTSTPRVAEEPVRSIPEFLKA
EVDEQNYSLMSSCEVYNLMKDEEEQRIVERRAEVREVLANARPTAPKGFWISAEWLRNWT
DSLKPPSAIDNSILLCEHERVSPKSIQLMKCISDAAWQSLHSKYGGQPVVTMESCCFECI
YADAAAAATAESFRSGRAAMKLMAENVMAGKGVEGHLFYVSRSWLVQWMRKKAALDTLGD
GDLNPTSAITCRHNALLPDDAAGAKRQVVPEVLWSYFYQNAVVVGGEEQRGHKPFPVNTE
NCKICEAEHSHTLTKCLMLSFRATKMEQRQKQEAIFSGRNPVLNPGDVYYLVPSSWISLW
RAYIGASGKNVLDIEEPVGLERFLSSLLCKHGGLLYNPPALTRTRRGELVQKASSDDVQV
VVSRDDWVYFCQQWDANAGKGIRAYVEEAQMPDRPEKELSELKLPILRTEPEVCRECIDD
RETTELVHKLNYTNATITVDLVQGKEPPPSLVFAAANQDAERRTSKRARRTVATGNKQVK
LTVSGTTTVYQLKMLIWEWLGVVKENQEVHFGKVELTDESTTLADVGVLPNSQLWVSDSG
LHEHRDIAGKPMLSLFIYVSLIASLWFSQTSSRLHSRATLKKVLGGRGF
NT seq 3030 nt NT seq  +upstreamnt  +downstreamnt
aggagaatccacctcacgaagattgtgaccgaggaagatctccggtggttctttcatctc
gatcggccagcctgccagggatgccgcggcaataccaaggataatccgctgtgcctctgt
ggcttagttcccccggcaaacggtacgagaaagcatgggctctggcagaagctatcggac
atcatcgacgagctgggtccggatccatcgagggagctgagggtgatggacattccagcg
gggttgaccaatcttggagccacttgctacgtcaacagcgtgctccagtgtctcttcatg
aacaccaccttccggaatggggtcttttccgcggagatggagctggtgagaaacgatccg
gtgcttcaccagctcgctcggctctttgcgcagctccattcgggaaccaagagctcggtg
gactcggctgcgtttgcgaccacgctggagctggacaacgccgtccagcaggacgggcag
gagtttctgaagcttctcctcacgctactggagcgagttcttgcgcagtcgagagttccg
gaggcgcgagacgtggtgcaaaacctcttccgcgggacgttttcatacgttacgaagtgc
tcgagctgcggtaaggagtccggcgcttcggatcagttcgttgatttctacgagttagaa
gtgaacgtaaaaggcttctcgagtctggaagagtcgctggatgattatctcaacgaggag
aagctttcgggagagaatcagtacttttgcgagtactgcaaagctagagtggatgccacg
cacagcacaaagctcagattactacctcctgtcttgaattttcagctcaagagatttgtg
ttcaatctcaagacttcgacgaagaagaaagtcacgtcaaaatttatgtttccaaaggtc
ctggacatggaacgacgagtatcgcctgtgacatccgatggctctcccggcgagccagcg
cactacgatctttttgcgattttaatgcacaagggcaacatggccagcagtggacactac
gtagtacatatcagggacgagagaacggggcagtggtggcagttcgacgacgaggaggta
acgatgcttggctccaatcctctgggagagccaacatctaaacttgataaggtatctcct
gatagggacgacaatttactgatgtctccggatgcttacatgctaatgttttcccgtcga
acgagcacgccgagagttgccgaagaaccagtcaggagtatacccgagttcttgaaggca
gaagtcgatgagcagaattacagtcttatgagtagctgcgaggtttacaatctcatgaag
gatgaggaggaacagagaattgtcgaaagaagggcagaagttcgagaggttctggctaat
gcacgaccgacagctccaaaaggcttctggatttccgcagagtggctccgcaattggact
gacagcttaaaaccaccatcggccattgataatagcatcttattgtgcgaacacgaacgt
gtttctcccaagagtattcaactgatgaaatgcatatccgatgctgcttggcagagcttg
cattcgaagtatggaggccagccagttgtaaccatggaaagctgttgtttcgaatgtatt
tatgccgatgctgctgctgctgctacggcagaaagctttcgaagcggaagagcagcaatg
aaattaatggctgaaaacgttatggctgggaagggcgttgaaggtcacttgttttacgtg
tccagatcctggctcgtgcaatggatgcgcaagaaggctgccctggacacactaggagat
ggtgatttaaatccaacaagtgccataacttgtcgtcacaatgcattgcttcctgacgac
gctgcgggtgcaaaacggcaagtcgtgcctgaggttttatggtcctacttttaccaaaat
gctgttgttgttggcggagaagaacaacgtggacacaagccgtttcctgtaaacacggag
aattgcaagatttgcgaagccgagcactcacacactctaacgaaatgcttaatgctatct
ttcagagctacaaagatggaacaacgtcagaaacaggaggcaatattttctggacggaat
cccgtacttaatcccggagatgtttattacctcgttccctctagttggatttctctctgg
cgtgcgtacatcggagccagtgggaaaaatgtgctagatatcgaggagcctgtgggactc
gaaaggtttctttcgtctcttctttgcaagcatggtggacttctctataatcccccagcc
ttaacaaggaccaggcggggagaactcgtacaaaaagcatcttctgatgacgttcaagtt
gtggtctctcgagatgattgggtctatttttgtcagcagtgggatgcaaatgctggcaag
ggcattcgagcatatgttgaggaagcacaaatgcctgatcgtccagaaaaagaattaagt
gaactcaaactgcctattcttagaacagaacctgaggtttgcagggagtgtatagacgac
cgggagactactgaactcgtgcacaagcttaactataccaatgcaactatcaccgtggat
cttgtccaagggaaagagccacctccttctcttgtctttgcggcggctaaccaggacgcc
gagagaagaacgtcaaagcgtgcgcgcaggactgtggccaccggaaacaagcaagtgaag
ctcacagtttctggaaccacgacggtctaccagctgaagatgcttatttgggagtggctc
ggggttgtgaaagaaaaccaggaagttcattttgggaaagtggagcttactgacgaatcg
actacactcgcagacgtgggtgttctgccaaattcacagttgtgggtttcggacagcgga
ctacacgaacatcgagatattgcaggcaagccgatgctttctttgtttatttatgtcagc
ctgattgcatcgctatggttttcgcagacgagctctcgactccacagcagggccacgttg
aagaaggttttagggggacgcggcttttag

DBGET integrated database retrieval system