KEGG   Selaginella moellendorffii: SELMODRAFT_76344Help
Entry
SELMODRAFT_76344  CDS       T01496                                 

Definition
hypothetical protein
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
smo  Selaginella moellendorffii
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:smo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SELMODRAFT_76344
Enzymes [BR:smo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     SELMODRAFT_76344
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 470 aa AA seqDB search
MGALPIAEFVSSASSASDSDRSAASDEDCLVDDGDGDLVADSRLVSSVRALLQGLGEDLS
RNGLIKTPSRVANAFLSATKGYGLSAEQTIGGALFAEAGPGNGKGGGCGGMVVVRNIELF
STCESCLLPFKLCCHIAYIPSEQRVVGLSKLPRVAEIFAARLQSPDRLANEIAGALWDGF
KPLGVAVVGETWHLECPRELRSSKEPASWIRRSVCARKGSFEDDDRGSEDWQEFVAMLQL
SGSSQLSVTKKPAICPLLAGDAAAERSSHPNFETMVEAVVTLLRALGEDPTREELKLTPS
RYVRWLLASTHGSRLSRDFILGNGVAAVEQDGDHHVTMVAVLDLPFCSQCEHHLLPFSGV
AHVGVLPAKNHPSSHPRASRGILEKIVKLYSCRLQVQERLTRQIADAVMSSTAASGVMVV
VEAGHVCMISRGVKKTGSTTGTLATMGDFAVHGKKRAEFLQMIATANSSK
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atgggggcattgccgatcgcggagtttgtgagcagcgccagcagcgccagcgattccgat
aggtcagcagccagcgacgaggattgtctcgtggacgacggcgacggcgatctggtagcc
gattcgcggctggtgagctcggtgcgcgcgctgctccaggggctgggcgaggatctctcg
cgcaatggactgatcaagacgccgtccagggtcgccaatgccttcctctctgccactaaa
ggctatggactctcggcggagcaaaccatcggtggagctctctttgcagaagcgggccct
ggaaacggcaaaggtggcggctgcggaggaatggtggtggtccgaaacatcgagctcttc
tccacctgcgagtcctgcctcttaccattcaagctctgctgtcacatcgcttacattccc
tccgagcagcgcgtcgtcggcctcagcaagctcccccgcgtcgcggagatcttcgcagct
cggctccaaagcccggatcgtctcgccaacgagatcgcaggagctctctgggacggattt
aagcctctcggggtggccgtggttggagagacttggcatctcgagtgtccccgcgagctt
cgaagcagcaaggagccggcttcctggattcgacgatcggtctgcgccaggaaaggcagc
ttcgaggacgacgatcgtggctcggaagactggcaagagttcgttgccatgctccagctg
agtggaagctcgcagctctcggtgacgaagaagccggcgatctgtccgctactagccggt
gacgccgccgctgagagatcttcgcaccccaactttgagacgatggtcgaggcggtggtg
acgctgctgcgagctcttggcgaagatccaacgcgggaggagctcaagctcacgccttct
cgctacgttcgctggctgctagcatcaacgcacgggagccggctctctagggacttcata
ctcgggaatggagtagcagcagtagaacaggatggcgatcaccacgtgacgatggtagct
gtgctggatcttccattctgttcccaatgcgagcaccatcttcttccattctccggagtg
gctcacgtcggagttcttccagcgaaaaaccacccgagctctcatcccagagctagtcgg
ggcatcctcgagaagattgtcaagctgtacagctgccggctccaagtccaggagagattg
acgaggcaaatcgccgacgctgtgatgagctccactgctgctagcggcgtcatggttgtc
gtcgaggctgggcacgtctgtatgatctctcgaggcgtgaagaaaaccggcagcactaca
ggaacgctggcgacaatgggcgattttgccgtccatggcaagaagcgggcggagttctta
cagatgatcgctactgcaaactcttccaagtaa

DBGET integrated database retrieval system