KEGG   Selaginella moellendorffii: SELMODRAFT_78329Help
Entry
SELMODRAFT_78329  CDS       T01496                                 

Definition
hypothetical protein
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
smo  Selaginella moellendorffii
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Glycosphingolipid biosynthesis - globo series
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:smo00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:smo00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:smo00600]
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - globo series [PATH:smo00603]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 390 aa AA seqDB search
MAAKNYLVLLVLLLTDLVRSSDSFERHRLLENGLGRTPPMGWNSWNYFHCGINEEIIRAT
TDAIVSTGLRDVGYEYVNIDDCWAELSRDNEGNLQARNSTFPSGIKALADYVHSKNLKFG
IYSDAGYLTCQEQPGSLNHEDQDAKTFAAWGVDYLKYDNCHTDGSSPRIRYPIMRDALSA
AGRPIFFSMCEWGQEDPATWASSVGNSWRTTGDIENKWESMISIADKNNAWAEHAAPGGW
NDPDMLEIGNGGMSFQESRTHFSLWALMKAPLIIGCDVRNTVAQDLAILMNKEVIQINQD
ALGVQGRKVAGDGEQEVWGGPLSNGRFALLMLNRGSDPADITAEFAALGIPSNVSVMIRD
VWKVRTGTYNSSITSRVESHDVAMYILTPV
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atggccgccaagaattatctcgtgttgctggtgctgcttctcacggatctcgttcgatcc
agcgattcttttgagcgtcaccggctgctggagaatgggctgggaagaacaccgccaatg
ggatggaatagctggaattacttccactgtggaatcaacgaggagatcattcgagcaacc
actgatgcgattgtgtctactggcctcagagatgttggctacgagtatgtaaacattgat
gattgctgggcggagctttcacgagacaatgagggaaaccttcaagcacggaactccaca
ttcccgtcaggaatcaaagccttggctgactacgtgcattctaaaaacctcaagtttggg
atttactcggacgctggatacttgacgtgccaggaacagccaggatctttgaatcacgaa
gatcaagacgccaaaacttttgctgcatggggagtggattacttgaagtatgacaattgt
cacaccgatggaagctcaccgagaatccgataccccataatgcgcgacgctcttagtgcg
gcaggccggccgattttcttctcaatgtgtgaatggggtcaggaagatccagcaacatgg
gcatcgagcgtcggaaatagctggagaacaaccggggatatagagaacaaatgggaatcg
atgatttctatcgcggacaagaacaatgcgtgggccgagcacgccgctccgggaggatgg
aatgatccggacatgctggagatcggcaatggcggcatgagcttccaggaatcgcgcacg
cacttcagcttgtgggcgctcatgaaagcaccgttgattattggttgcgacgtacggaac
actgtggcccaggacctggccattctcatgaacaaagaggtgatccaaatcaaccaagat
gcgctaggggttcaaggaagaaaggtggcgggagatggagaacaagaggtgtggggaggc
ccgctctcaaacgggagatttgcgctcttgatgctcaatcgaggcagtgatccagctgat
atcacagccgaatttgctgcgcttggcattcctagtaacgtttcagtgatgatccgcgat
gtttggaaggtacgcacgggcacgtataattccagtattacatccagagttgaatcgcac
gatgtagccatgtacatacttactcctgtgtag

DBGET integrated database retrieval system