KEGG   Selaginella moellendorffii: SELMODRAFT_78329Help
Entry
SELMODRAFT_78329  CDS       T01496                                 

Definition
hypothetical protein
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
smo  Selaginella moellendorffii
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Glycosphingolipid biosynthesis - globo series
Brite
KEGG Orthology (KO) [BR:smo00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    SELMODRAFT_78329
  Lipid metabolism
   00561 Glycerolipid metabolism
    SELMODRAFT_78329
   00600 Sphingolipid metabolism
    SELMODRAFT_78329
  Glycan biosynthesis and metabolism
   00603 Glycosphingolipid biosynthesis - globo series
    SELMODRAFT_78329
Enzymes [BR:smo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     SELMODRAFT_78329
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 390 aa AA seqDB search
MAAKNYLVLLVLLLTDLVRSSDSFERHRLLENGLGRTPPMGWNSWNYFHCGINEEIIRAT
TDAIVSTGLRDVGYEYVNIDDCWAELSRDNEGNLQARNSTFPSGIKALADYVHSKNLKFG
IYSDAGYLTCQEQPGSLNHEDQDAKTFAAWGVDYLKYDNCHTDGSSPRIRYPIMRDALSA
AGRPIFFSMCEWGQEDPATWASSVGNSWRTTGDIENKWESMISIADKNNAWAEHAAPGGW
NDPDMLEIGNGGMSFQESRTHFSLWALMKAPLIIGCDVRNTVAQDLAILMNKEVIQINQD
ALGVQGRKVAGDGEQEVWGGPLSNGRFALLMLNRGSDPADITAEFAALGIPSNVSVMIRD
VWKVRTGTYNSSITSRVESHDVAMYILTPV
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atggccgccaagaattatctcgtgttgctggtgctgcttctcacggatctcgttcgatcc
agcgattcttttgagcgtcaccggctgctggagaatgggctgggaagaacaccgccaatg
ggatggaatagctggaattacttccactgtggaatcaacgaggagatcattcgagcaacc
actgatgcgattgtgtctactggcctcagagatgttggctacgagtatgtaaacattgat
gattgctgggcggagctttcacgagacaatgagggaaaccttcaagcacggaactccaca
ttcccgtcaggaatcaaagccttggctgactacgtgcattctaaaaacctcaagtttggg
atttactcggacgctggatacttgacgtgccaggaacagccaggatctttgaatcacgaa
gatcaagacgccaaaacttttgctgcatggggagtggattacttgaagtatgacaattgt
cacaccgatggaagctcaccgagaatccgataccccataatgcgcgacgctcttagtgcg
gcaggccggccgattttcttctcaatgtgtgaatggggtcaggaagatccagcaacatgg
gcatcgagcgtcggaaatagctggagaacaaccggggatatagagaacaaatgggaatcg
atgatttctatcgcggacaagaacaatgcgtgggccgagcacgccgctccgggaggatgg
aatgatccggacatgctggagatcggcaatggcggcatgagcttccaggaatcgcgcacg
cacttcagcttgtgggcgctcatgaaagcaccgttgattattggttgcgacgtacggaac
actgtggcccaggacctggccattctcatgaacaaagaggtgatccaaatcaaccaagat
gcgctaggggttcaaggaagaaaggtggcgggagatggagaacaagaggtgtggggaggc
ccgctctcaaacgggagatttgcgctcttgatgctcaatcgaggcagtgatccagctgat
atcacagccgaatttgctgcgcttggcattcctagtaacgtttcagtgatgatccgcgat
gtttggaaggtacgcacgggcacgtataattccagtattacatccagagttgaatcgcac
gatgtagccatgtacatacttactcctgtgtag

DBGET integrated database retrieval system