KEGG   Selaginella moellendorffii: SELMODRAFT_80089Help
Entry
SELMODRAFT_80089  CDS       T01496                                 

Definition
(RefSeq) hypothetical protein
  KO
K06001  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
smo  Selaginella moellendorffii
Pathway
smo00260  Glycine, serine and threonine metabolism
smo00400  Phenylalanine, tyrosine and tryptophan biosynthesis
smo01100  Metabolic pathways
smo01110  Biosynthesis of secondary metabolites
smo01230  Biosynthesis of amino acids
Module
smo_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:smo00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SELMODRAFT_80089
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SELMODRAFT_80089
Enzymes [BR:smo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SELMODRAFT_80089
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-GeneID: 9643468
NCBI-ProteinID: XP_002963667
JGI: 80089
UniProt: D8QY28
Position
Unknown
AA seq 479 aa AA seqDB search
MHHRVLRLRLYDVPATRRLLSVRRCGSNTKVSLDEKDLPAKWYNITADLPQPPPPPLDPR
SLEPLKAEGMGALFPQELIRQEMSSDRYIGIPDEVLAVYKLWRPTPLFRAKRLERLLETP
ARIYYKYEGVSPAGSHKPNTAVPQAFYNAKEGIKRLTTETGAGQWGSALAFACSIFNLDC
EVWQVRASYDQKPHRKTMMETWGAKVYPSPSAITATGRKMLAEDPNCPGSLGLAISEAVE
VAVQDSNTHYALGSVLNHVLLHQTVIGEECLLQLAKAGETDVDILIGCTGGGSNFGGLAF
PFLREKFAGKMNPVIRAVEPAACPSLTRGVYAYDYGDTAGFTPLMKMHTLGHDFIPDPIH
AGGLRYHGMAPLISHLYNLKLMEAIAIPQKECFQGALQFARSEGIIPAPEPTHAIAATIR
EAERCRESGEAKVIVLALCGHGHFDLASYEKFLSGEIEDLDYSDEKAAAAMASIPVVKQ
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgcaccatagagttctccggctccggctgtatgatgttcctgctacgagaaggctgtta
tcggttagaaggtgtggcagcaacacaaaggttagtctggatgagaaggatcttccagca
aaatggtacaacattaccgcagatttgccgcagccgccgccgcctcctctggatcctaga
agcttggagccgttgaaagcagagggcatgggggctttatttccccaagaacttattcgc
caggagatgtccagcgatcgctacattggcattccagacgaggtcctcgcggtgtacaag
ctgtggaggccaacgcctctcttcagggccaagcgactagaacggttgctagaaactcct
gcaaggatatactacaagtacgagggtgtgagtccagcgggatcacacaagccgaacacg
gccgtcccacaggcgttttacaatgccaaggaaggaatcaagcgtctcaccactgaaact
ggtgctggacagtggggaagcgctctggcttttgcttgctcaatcttcaatctcgactgc
gaggtatggcaggttcgtgcatcttacgaccagaagccacacaggaagacgatgatggag
acgtggggagcgaaagtttacccctccccctcggctattacagccacgggccgcaaaatg
ctagccgaggatccgaactgtccgggaagcctgggccttgccatctctgaagccgtggaa
gttgctgtccaagactcgaacacgcactacgcactggggagcgtcctcaatcacgtcctt
ctccaccagacggtgatcggcgaggaatgcttgcttcagctggccaaagccggagagacc
gacgtggacatactcatcggttgcaccggcggcggatcgaactttggaggcttggctttc
ccgtttctgcgggagaagttcgcagggaagatgaatccggtgatccgagcagtcgagccg
gcggcttgtccatcactcacaagaggagtgtacgcttacgactatggtgacactgccggg
tttacgcccctgatgaagatgcatacgctcgggcacgactttattccagatcccatccat
gctggaggattgaggtaccatggaatggcaccgctgatatcacacctctacaatcttaag
ctcatggaggccatagctataccgcagaaagaatgcttccaaggagctctacaatttgct
cgaagcgaaggaataattccagcacctgagccaactcacgcgatcgctgctacgatccgt
gaagcggagcgatgccgagagagtggcgaggccaaagtgattgtcttggcactgtgcggc
cacggccactttgatctcgcctcgtacgagaagtttctgagtggagagatcgaagatctc
gactattccgacgagaaagccgcggcagcgatggcctccattcccgttgtcaagcagtaa

DBGET integrated database retrieval system