KEGG   Selaginella moellendorffii: SELMODRAFT_80180Help
Entry
SELMODRAFT_80180  CDS       T01496                                 

Definition
hypothetical protein
Orthology
K13941  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase / dihydropteroate synthase [EC:2.7.6.3 2.5.1.15]
Organism
smo  Selaginella moellendorffii
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:smo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SELMODRAFT_80180
Enzymes [BR:smo01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     SELMODRAFT_80180
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     SELMODRAFT_80180
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 506 aa AA seqDB search
MRIESRVAVRFQNATTSGRLDRSSHRHFHSDEASAARVSLKSRKLEEVVIAIGGNIGDRV
RNFDTALRMMRSSGIQIKKHACLYETAPMHLLDQPLFLNSAVTATTSLDPHELLVALKEI
ERKLGRSQGGVKYGPRPIDLDIIFYGDLELSSENLRVPHPMFSGRPFVLAPLLDLLGPEV
EDSRHWSLVHQVRRHWNDIGGEGCVKREGMKKVLPVGGKLLDWQERTYVMGVLNVTPDSF
SDGGKFFTADKAVKQVQEMIEQGADFIDVGAQSTRPNAERLTTEEELRRIVPVLEGLKST
PDRSRVVLSVDTFDSNVARAAVELGADLINDVSGGSLDPKMLGTVAELGVPCVLMHMRGD
PCTMLSEANTSYSDLPRDVARELAVSIEQAEVAGVPAWKIIADPGFGFSKTAEQNVELLA
RLDTFRSGLTQARFGVGSIPVLAGISRKAFLGQIVGCSRAEDRDNATIAAATTAILKGAN
VIRAHNVKAVRDGAMVADSIRKVLAS
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgaggattgaatctcgcgtagcggtcaggttccagaatgccacgaccagcggcaggctg
gatcgatcgtcccaccggcacttccattccgatgaagcatcggcggccagggtctctctc
aaatccaggaagctggaggaggttgtcatcgcgatcggggggaatatcggcgaccgggtc
aggaatttcgacacggcgctgaggatgatgcgaagctctggaatccagatcaagaagcac
gcctgcctgtacgagacagcgccaatgcatttgctggatcagcctctcttcctcaactcg
gccgtgactgccacaacgagcctggatcctcacgagctgctggtggccttgaaggagatt
gagagaaagctggggcgcagccaaggtggtgtcaagtatggaccgaggccgatcgatctc
gacatcattttctacggggatttggagctcagctcggagaacttgcgggttcctcatcct
atgttctctgggaggcctttcgtgctggctccgctcctcgatcttcttggtccggaagtg
gaggatagcaggcattggtctttggtccatcaagttcggagacactggaacgatataggt
ggcgaaggatgcgtcaagagagaagggatgaagaaggtgcttcctgtgggtggaaagctt
ctggactggcaggagaggacttacgtgatgggggttcttaatgtcactccggacagcttt
agcgatggtggcaagttcttcacagctgacaaagcagtgaagcaagtccaggaaatgatc
gaacaaggagccgacttcatagatgttggagcgcaatcgacaaggccaaatgccgagcgt
cttaccactgaggaggagcttcgacggatcgtgccagtgctggagggtctgaagagcaca
ccggacagatccagggtcgtgctctcggtggataccttcgactccaacgttgcaagagca
gctgtagagctgggtgctgatctgataaacgatgtctcgggtggcagcttggatccgaag
atgctggggacagtagccgagctgggggttccttgtgtgctaatgcatatgaggggcgat
ccatgcacgatgctgagtgaagccaacacaagttacagcgatctaccacgagacgtggcc
agggaactcgctgtgagcatcgaacaagccgaggttgctggagttccggcatggaagatt
atagctgacccggggtttggattctcgaagaccgccgagcagaacgtggagctgctggcg
aggcttgatacgttcagatccgggctgacgcaggcgagatttggggttggaagtatcccg
gttctggcagggatctcgaggaaagcttttcttggtcagatcgttggctgctccagggcc
gaagaccgggacaatgccacgatcgctgctgctacgacagcgattttaaagggtgcgaat
gttataagagcccacaacgtaaaagctgttcgagatggcgctatggtggctgactcgatc
cgcaaagtcctggcaagctaa

DBGET integrated database retrieval system